- Description of Target:
- WDR4 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes.This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes. Two transcript variants encoding the same protein have been found for this gene.
- Gene Symbol:
- WDR4
- Official Gene Full Name:
- WD repeat domain 4
- Alias Symbols:
- TRM82
- Tissue Tool:
- Find tissues and cell lines supported to express WDR4.
- Protein Accession# :
- NP_387510
- Nucleotide Accession#:
- NM_033661
- Swissprot Id:
- P57081
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 412
- Molecular Weight:
- 45kDa
- Application:
- WB, IHC
- Subunit:
- WDR4
- Immunogen:
- The immunogen for anti-WDR4 antibody: synthetic peptide directed towards the C terminal of human WDR4
- Product Format:
- Lyophilized powder
- Purification:
- Protein A purified
- Complete computational species homology data:
- WDR4 antibody - C-terminal region (ARP41321_T100)
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%; Bovine: 92%; Horse: 92%; Mouse: 86%; Rat: 80%
- Datasheets / Downloads:
- Printable datasheet for
anti-WDR4 antibody
- ARP41321_T100 - Peptide Sequence:
- Synthetic peptide located within the following region: AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHA
- Blocking Peptide:
- For anti-WDR4 antibody is Catalog # AAP41321 (Previous Catalog # AAPP22676)
- Key Reference:
- Michaud,J., (2000) Genomics 68 (1), 71-79
- Reconstitution and Storage:
- Add 100 μl of distilled water. Final anti-WDR4 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: WDR4 antibody tested with Human Hepg2 Cells (ARP41321_T100)
Aviva Systems Biology is the original manufacturer of this WDR4 antibody (ARP41321_T100)
Click here to view the WDR4 antibody Western Blot Protocol
Product Datasheet Link: WDR4 antibody (ARP41321_T100)
WB Suggested Anti-WDR4 Antibody Titration: 1.25ug/ml
Positive Control: HepG2
Western Blot image: 
Description of Target: WDR4 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes.This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes. Two transcript variants encoding the same protein have been found for this gene.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s WDR4 antibody (ARP41321_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
Product Protocols: WDR4 antibody tested by IHC with human kidney (ARP41321)
Aviva Systems Biology is the original manufacturer of this WDR4 antibody.
Click here to view the WDR4 antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: WDR4 antibody (ARP41321)
IHC Information:
Rabbit Anti-WDR4 Antibody
Catalog Number: ARP41321
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
