- Description of Target:
- Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand.Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand.
- Gene Symbol:
- FZD5
- Official Gene Full Name:
- Frizzled family receptor 5
- Alias Symbols:
- C2orf31; DKFZp434E2135; HFZ5; MGC129692
- Tissue Tool:
- Find tissues and cell lines supported to express FZD5.
- Protein Accession# :
- NP_003459
- Nucleotide Accession#:
- NM_003468
- Swissprot Id:
- Q13467
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 585
- Molecular Weight:
- 64kDa
- Application:
- WB
- Partner Proteins:
- GOPC, LRP6, ROR2, WNT5A, WNT7A
- Immunogen:
- The immunogen for anti-FZD5 antibody: synthetic peptide directed towards the C terminal of human FZD5
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- FZD5 antibody - C-terminal region (ARP41245_P050)
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%; Bovine: 92%; Rat: 92%; Mouse: 85%
- Datasheets / Downloads:
- Printable datasheet for
anti-FZD5 antibody
- ARP41245_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: SRCCCRPRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAATYHKQVSLSH
- Blocking Peptide:
- For anti-FZD5 antibody is Catalog # AAP41245 (Previous Catalog # AAPS01412)
- Key Reference:
- Holmen,S.L., (2005) Biochem. Biophys. Res. Commun. 328 (2), 533-539
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-FZD5 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: FZD5 antibody tested with Human Hepg2 Cells (ARP41245_P050)
Aviva Systems Biology is the original manufacturer of this FZD5 antibody (ARP41245_P050)
Click here to view the FZD5 antibody Western Blot Protocol
Product Datasheet Link: FZD5 antibody (ARP41245_P050)
WB Suggested Anti-FZD5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2
Western Blot image: 
Description of Target: Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand.Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s FZD5 antibody (ARP41245_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
