- Description of Target:
- The function of this protein remains unknown.
- Gene Symbol:
- 9330134C04Rik
- Official Gene Full Name:
- RIKEN cDNA 9330134C04 gene
- Alias Symbols:
- Sr278
- Tissue Tool:
- Find tissues and cell lines supported to express 9330134C04Rik.

- Protein Accession# :
- NP_001013626
- Nucleotide Accession#:
- NM_001013608
- Swissprot Id:
- Q6DI94
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 585
- Molecular Weight:
- 66kDa
- Application:
- WB
- Product Format:
- Lyophilized powder
- Complete computational species homology data:
- 9330134C04Rik antibody - C-terminal region (ARP36473_P050)
- Datasheets / Downloads:
- Printable datasheet for
anti-9330134C04Rik antibody
- ARP36473_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: SSRAENHMSRWATRDVFELKQFSQLPANVAVCSSKTYKTQVKANIVSPTE
- Blocking Peptide:
- For anti-9330134C04Rik antibody is Catalog # AAP36473 (Previous Catalog # AAPP08532)
- Key Reference:
- N/A
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-9330134C04Rik antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
- Protocol:
- Tips Information:
See our General FAQ page.


