Catalog No: ARP35330_P050
Price: $0.00
SKU
ARP35330_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TRPV4 (ARP35330_P050) antibody
Product Info
Tested Species ReactivityHuman, Rat
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TRPV4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 86%; Guinea Pig: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR
Concentration0.5 mg/ml
Blocking PeptideFor anti-TRPV4 (ARP35330_P050) antibody is Catalog # AAP35330 (Previous Catalog # AAPP06566)
ReferenceCorey,D.P. (er) Pflugers Arch. (2008) In press
Gene SymbolTRPV4
Gene Full NameTransient receptor potential cation channel, subfamily V, member 4
Alias SymbolsSMAL, VRL2, BCYM3, CMT2C, SPSMA, TRP12, VROAC, HMSN2C, OTRPC4, SSQTL1
NCBI Gene Id59341
Protein NameTransient receptor potential cation channel subfamily V member 4
Description of TargetTRPV4 is a non-selective calcium permeant cation channel probably involved in osmotic sensitivity and mechanosensitivity. Activation of TRPV4 by exposure to hypotonicity within the physiological range exhibits an outward rectification. TRPV4 also activated by low pH, citrate and phorbol esters and increase of intracellular Ca2+ potentiates currents. Channel activity seems to be regulated by a calmodulin-dependent mechanism with a negative feedback mechanism.Defects in TRPV4 are the cause of brachyolmia type 3 (BRAC3) This gene encodes a member of the OSM9-like transient receptor potential channel (OTRPC) subfamily in the transient receptor potential (TRP) superfamily of ion channels. The encoded protein is a Ca2+-permeable, nonselective cation channel that is thought to be involved in the regulation of systemic osmotic pressure. Two transcript variants encoding different isoforms have been found for this gene.
Uniprot IDQ9HBA0-2
Protein Accession #NP_671737
Nucleotide Accession #NM_147204
Protein Size (# AA)811
Molecular Weight91kDa
Protein InteractionsUBC; ARRB2; KRIT1; ITCH; PACSIN3; PACSIN1; TRPV4; PACSIN2; MAP7; SRC; LYN; YES1; LCK; HCK; FYN; CALM1; OS9; PACS1;
  1. What is the species homology for "TRPV4 Antibody - middle region (ARP35330_P050)"?

    The tested species reactivity for this item is "Human, Rat". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit".

  2. How long will it take to receive "TRPV4 Antibody - middle region (ARP35330_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TRPV4 Antibody - middle region (ARP35330_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TRPV4 Antibody - middle region (ARP35330_P050)"?

    This target may also be called "SMAL, VRL2, BCYM3, CMT2C, SPSMA, TRP12, VROAC, HMSN2C, OTRPC4, SSQTL1" in publications.

  5. What is the shipping cost for "TRPV4 Antibody - middle region (ARP35330_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TRPV4 Antibody - middle region (ARP35330_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TRPV4 Antibody - middle region (ARP35330_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "91kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TRPV4 Antibody - middle region (ARP35330_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TRPV4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TRPV4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TRPV4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TRPV4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TRPV4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TRPV4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TRPV4 Antibody - middle region (ARP35330_P050)
Your Rating
We found other products you might like!