SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP49878_P050
Price: $0.00
SKU
ARP49878_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TREML2 (ARP49878_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Dog
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TREML2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 79%; Human: 100%
Peptide SequenceSynthetic peptide located within the following region: TGYSFTATSTTSQGPRRTMGSQTVTASPSNARDSSAGPESISTKSGDLST
Concentration0.5 mg/ml
Blocking PeptideFor anti-TREML2 (ARP49878_P050) antibody is Catalog # AAP49878 (Previous Catalog # AAPY02742)
Sample Type Confirmation

TREML2 is supported by BioGPS gene expression data to be expressed in 721_B

ReferenceKing,R.G., (2006) J. Immunol. 176 (10), 6012-6021
Gene SymbolTREML2
Gene Full NameTriggering receptor expressed on myeloid cells-like 2
Alias SymbolsTLT2, TLT-2, C6orf76, dJ238O23.1
NCBI Gene Id79865
Protein NameTrem-like transcript 2 protein
Description of TargetTREML2 is a single-pass type I membrane protein, and it contains 1 Ig-like V-type (immunoglobulin-like) domain. TREML2 is a cell surface receptor that may play a role in the innate and adaptive immune response. TREML2 is located in a gene cluster on chromosome 6 with the single Ig variable (IgV) domain activating receptors TREM1 (MIM 605085) and TREM2 (MIM 605086), but it has distinct structural and functional properties (Allcock et al., 2003 [PubMed 12645956]).[supplied by OMIM]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1294 AY358171.1 2-1295 1295-3758 AL133404.8 7920-10383
Uniprot IDQ5T2D2
Protein Accession #NP_079083
Nucleotide Accession #NM_024807
Protein Size (# AA)380
Molecular Weight41kDa
  1. What is the species homology for "TREML2 Antibody - middle region (ARP49878_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Dog".

  2. How long will it take to receive "TREML2 Antibody - middle region (ARP49878_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TREML2 Antibody - middle region (ARP49878_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TREML2 Antibody - middle region (ARP49878_P050)"?

    This target may also be called "TLT2, TLT-2, C6orf76, dJ238O23.1" in publications.

  5. What is the shipping cost for "TREML2 Antibody - middle region (ARP49878_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TREML2 Antibody - middle region (ARP49878_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TREML2 Antibody - middle region (ARP49878_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "41kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TREML2 Antibody - middle region (ARP49878_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TREML2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TREML2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TREML2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TREML2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TREML2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TREML2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TREML2 Antibody - middle region (ARP49878_P050)
Your Rating
We found other products you might like!