website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

TLR5 antibody - N-terminal region (ARP31753_P050)

Receive a free positive control (AHL001) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
TLR5 participates in the innate immune response to microbial agents. It mediates detection of bacterial flagellins. TLR5 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene product is expressed in myelomonocytic cells, and recognizes bacterial flagellin, a principal component of bacterial flagella and a virulence factor. The activation of this receptor mobilizes the nuclear factor NF-kappaB and stimulates tumour necrosis factor-alpha production. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
TLR5
Official Gene Full Name:
Toll-like receptor 5
NCBI Gene Id:
7100
Alias Symbols:
FLJ10052; MGC126430; MGC126431; SLEB1; TIL3
Tissue Tool:
Find tissues and cell lines supported to express TLR5.
Protein Accession #:
NP_003259
Nucleotide Accession#:
NM_003268
Swissprot Id:
O60602
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Toll-like receptor 5
Protein Size (# AA):
858
Molecular Weight:
98kDa
Application:
WB
Partner Proteins:
BTK, TLR2, TRAP1
Immunogen:
The immunogen for anti-TLR5 antibody: synthetic peptide directed towards the N terminal of human TLR5
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
TLR5 antibody - N-terminal region (ARP31753_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 83%; Rat: 79%; Goat: 79%; Sheep: 79%; Bovine: 79%
Species Reactivity:
Human, Pig, Bovine, Sheep, Rat, Goat
Datasheets / Downloads:
Printable datasheet for
anti-TLR5 antibody
- ARP31753_P050
Peptide Sequence:
Synthetic peptide located within the following region: QLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFH
Blocking Peptide:
For anti-TLR5 antibody is Catalog # AAP31753 (Previous Catalog # AAPP23838)
Key Reference:
Hume,G.E., (2008) Inflamm. Bowel Dis. 14 (5), 585-590
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-TLR5 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question