website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TLR5 antibody - N-terminal region (ARP31753_P050)

  • Catalog#: ARP31753_P050
  • Domestic: within 1-2 days delivery International: 1-2 days
    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges
    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Free trial-size samples may be available for this item. Please go here for more information.
Print Page
100 ul
    In Stock

    Conjugation Options

    ARP31753_P050-FITC Conjugated

    ARP31753_P050-HRP Conjugated

    ARP31753_P050-Biotin Conjugated

    Free trial-size samples may be available for this item. Please go here for more information.
    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    Toll-like receptor 5
    Protein Name:
    Toll-like receptor 5
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    FLJ10052, MGC126430, MGC126431, SLEB1, TIL3
    Replacement Item:
    This antibody may replace item sc-10742 from Santa Cruz Biotechnology.
    Description of Target:
    TLR5 participates in the innate immune response to microbial agents. It mediates detection of bacterial flagellins. TLR5 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene product is expressed in myelomonocytic cells, and recognizes bacterial flagellin, a principal component of bacterial flagella and a virulence factor. The activation of this receptor mobilizes the nuclear factor NF-kappaB and stimulates tumour necrosis factor-alpha production. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
    Protein Size (# AA):
    Molecular Weight:
    Affinity Purified
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express TLR5.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express TLR5.
    The immunogen is a synthetic peptide directed towards the N terminal region of human TLR5
    Species Reactivity:
    Cow, Goat, Human, Pig, Rat, Sheep
    Predicted Homology Based on Immunogen Sequence:
    Cow: 79%; Goat: 79%; Human: 100%; Pig: 83%; Rat: 79%; Sheep: 79%
    Complete computational species homology data:
    Anti-TLR5 (ARP31753_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: QLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFH
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    RNF216; SIGIRR; TLR4; MYD88; TLR1;
    Blocking Peptide:
    For anti-TLR5 (ARP31753_P050) antibody is Catalog # AAP31753 (Previous Catalog # AAPP23838)
    Datasheets / Downloads:
    Printable datasheet for anti-TLR5 (ARP31753_P050) antibody
    Target Reference:
    Hume,G.E., (2008) Inflamm. Bowel Dis. 14 (5), 585-590

    Product Protocols: TLR5 antibody tested with Human Hepg2 Cells (ARP31753_P050)

    Aviva Systems Biology is the original manufacturer of this TLR5 antibody (ARP31753_P050)

    Click here to view the TLR5 antibody Western Blot Protocol

    Product Datasheet Link: TLR5 antibody (ARP31753_P050)

    WB Suggested Anti-TLR5 Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:312500
    Positive Control: HepG2

    Western Blot image:

    Description of Target: TLR5 participates in the innate immune response to microbial agents. It mediates detection of bacterial flagellins. TLR5 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene product is expressed in myelomonocytic cells, and recognizes bacterial flagellin, a principal component of bacterial flagella and a virulence factor. The activation of this receptor mobilizes the nuclear factor NF-kappaB and stimulates tumour necrosis factor-alpha production. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

    Questions pertaining to this data can be directed to

    Aviva Systems Biology’s TLR5 antibody (ARP31753_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

    Ask a Question