website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

TLR5 antibody - N-terminal region (ARP31753_P050)

Receive a free positive control (AHL001) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
TLR5 participates in the innate immune response to microbial agents. It mediates detection of bacterial flagellins. TLR5 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene product is expressed in myelomonocytic cells, and recognizes bacterial flagellin, a principal component of bacterial flagella and a virulence factor. The activation of this receptor mobilizes the nuclear factor NF-kappaB and stimulates tumour necrosis factor-alpha production. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
Toll-like receptor 5
NCBI Gene Id:
Alias Symbols:
FLJ10052; MGC126430; MGC126431; SLEB1; TIL3
Tissue Tool:
Find tissues and cell lines supported to express TLR5.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Toll-like receptor 5
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-TLR5 antibody: synthetic peptide directed towards the N terminal of human TLR5
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
TLR5 antibody - N-terminal region (ARP31753_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 83%; Rat: 79%; Goat: 79%; Sheep: 79%; Bovine: 79%
Species Reactivity:
Human, Pig, Bovine, Sheep, Rat, Goat
Datasheets / Downloads:
Printable datasheet for
anti-TLR5 antibody
- ARP31753_P050
Peptide Sequence:
Synthetic peptide located within the following region: QLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFH
Blocking Peptide:
For anti-TLR5 antibody is Catalog # AAP31753 (Previous Catalog # AAPP23838)
Target Reference:
Hume,G.E., (2008) Inflamm. Bowel Dis. 14 (5), 585-590
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for TLR5 antibody (ARP31753)

Product page for TLR5 antibody (ARP31753)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Agile mangabey TLR5 antibody; Cercocebus agilis TLR5 antibody B9VGK7 92%
Allen swamp monkey TLR5 antibody; Allenopithecus nigroviridis TLR5 antibody B9VGK2 92%
Barbary macaque TLR5 antibody; Macaca sylvanus TLR5 antibody B9VGK6 92%
Black-and-white colobus monkey TLR5 antibody; Colobus guereza TLR5 antibody B9VGK0 85%
Black-handed spider monkey TLR5 antibody; Ateles geoffroyi TLR5 antibody B9VGL4 78%
Bornean orangutan TLR5 antibody; Pongo pygmaeus TLR5 antibody B9VGJ7 100%
Bornean orangutan TLR5 antibody; Pongo pygmaeus TLR5 antibody B3Y637 100%
Bos taurus x Bos indicus TLR5 antibody A7YK54 78%
Bovine TLR5 antibody; Bos taurus TLR5 antibody Q6GV18 78%
Bovine TLR5 antibody; Bos taurus TLR5 antibody Q2LDA0 78%
Brown-headed tamarin TLR5 antibody; Saguinus fuscicollis TLR5 antibody B9VGL1 78%
Cacajao rubicundus TLR5 antibody B9VGL0 78%
Chimpanzee TLR5 antibody; Pan troglodytes TLR5 antibody B3Y634 92%
Crab-eating macaque TLR5 antibody; Macaca fascicularis TLR5 antibody B3Y638 92%
Domestic water buffalo TLR5 antibody; Bubalus bubalis TLR5 antibody F4ZWB4 78%
Drill TLR5 antibody; Mandrillus leucophaeus TLR5 antibody B9VGK5 92%
Emperor tamarin TLR5 antibody; Saguinus imperator TLR5 antibody B9VGL2 78%
Gelada baboon TLR5 antibody; Theropithecus gelada TLR5 antibody B9VGK3 92%
Goat TLR5 antibody; Capra hircus TLR5 antibody E9M472 78%
Human TLR5 antibody; Homo sapiens TLR5 antibody O60602 100%
Human TLR5 antibody; Homo sapiens TLR5 antibody Q32MI2 100%
Human TLR5 antibody; Homo sapiens TLR5 antibody D1CS90 100%
Human TLR5 antibody; Homo sapiens TLR5 antibody D1CS89 100%
Human TLR5 antibody; Homo sapiens TLR5 antibody D1CS88 100%
Human TLR5 antibody; Homo sapiens TLR5 antibody D1CS87 100%
Human TLR5 antibody; Homo sapiens TLR5 antibody D1CS85 100%
Human TLR5 antibody; Homo sapiens TLR5 antibody D1CS84 100%
Human TLR5 antibody; Homo sapiens TLR5 antibody D1CS83 100%
Human TLR5 antibody; Homo sapiens TLR5 antibody D1CS82 100%
Human TLR5 antibody; Homo sapiens TLR5 antibody D1CS80 100%
Human TLR5 antibody; Homo sapiens TLR5 antibody D1CS79 100%
Human TLR5 antibody; Homo sapiens TLR5 antibody B9VJ77 100%
Human TLR5 antibody; Homo sapiens TLR5 antibody B9VJ75 100%
Human TLR5 antibody; Homo sapiens TLR5 antibody B9VJ73 100%
Human TLR5 antibody; Homo sapiens TLR5 antibody B9VJ72 100%
Human TLR5 antibody; Homo sapiens TLR5 antibody B9VJ70 100%
Human TLR5 antibody; Homo sapiens TLR5 antibody B9VJ69 100%
Human TLR5 antibody; Homo sapiens TLR5 antibody B9VJ68 100%
Human TLR5 antibody; Homo sapiens TLR5 antibody B9VJ65 100%
Human TLR5 antibody; Homo sapiens TLR5 antibody B9VJ63 100%
Human TLR5 antibody; Homo sapiens TLR5 antibody B9VJ61 100%
Lowland gorilla TLR5 antibody; Gorilla gorilla gorilla TLR5 antibody G3SHF1 100%
Mona monkey TLR5 antibody; Cercopithecus mona TLR5 antibody B9VGK1 92%
Monk saki TLR5 antibody; Pithecia monachus TLR5 antibody B9VGK8 78%
Northern white-cheeked gibbon TLR5 antibody; Nomascus leucogenys TLR5 antibody G1QHW1 92%
Olive baboon TLR5 antibody; Papio anubis TLR5 antibody B9VGK4 92%
Pan troglodytes troglodytes TLR5 antibody B9VH34 92%
Pan troglodytes troglodytes TLR5 antibody B9VH33 92%
Pan troglodytes troglodytes TLR5 antibody B9VH32 92%
Pan troglodytes verus TLR5 antibody B9VH18 92%
Pan troglodytes verus TLR5 antibody B9VH15 92%
Pan troglodytes verus TLR5 antibody B9VH14 92%
Pan troglodytes verus TLR5 antibody B9VH13 92%
Pileated gibbon TLR5 antibody; Hylobates pileatus TLR5 antibody B9VGJ9 92%
Pygmy chimpanzee TLR5 antibody; Pan paniscus TLR5 antibody B3Y635 92%
Rhesus macaque Mmu.3815 antibody; Macaca mulatta Mmu.3815 antibody F7G9P6 92%
Rhesus macaque TLR5 antibody; Macaca mulatta TLR5 antibody B3Y639 92%
Siamang TLR5 antibody; Hylobates syndactylus TLR5 antibody B9VGJ8 92%
western gorilla TLR5 antibody; Gorilla gorilla TLR5 antibody B3Y636 100%
western gorilla TLR5 antibody; Gorilla gorilla TLR5 antibody B9VGJ6 92%
White-faced saki TLR5 antibody; Pithecia pithecia TLR5 antibody B9VGK9 78%
White-tufted-ear marmoset TLR5 antibody; Callithrix jacchus TLR5 antibody F7HV85 78%
White-tufted-ear marmoset TLR5 antibody; Callithrix jacchus TLR5 antibody B9VGL3 78%
Zebu TLR5 antibody; Bos indicus TLR5 antibody D0EP63 78%
Zebu TLR5 antibody; Bos indicus TLR5 antibody A7YK60 78%
Zebu TLR5 antibody; Bos indicus TLR5 antibody A7YK55 78%

Product Protocols: TLR5 antibody tested with Human Hepg2 Cells (ARP31753_P050)

Aviva Systems Biology is the original manufacturer of this TLR5 antibody (ARP31753_P050)

Click here to view the TLR5 antibody Western Blot Protocol

Product Datasheet Link: TLR5 antibody (ARP31753_P050)

WB Suggested Anti-TLR5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2

Western Blot image:

Description of Target: TLR5 participates in the innate immune response to microbial agents. It mediates detection of bacterial flagellins. TLR5 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene product is expressed in myelomonocytic cells, and recognizes bacterial flagellin, a principal component of bacterial flagella and a virulence factor. The activation of this receptor mobilizes the nuclear factor NF-kappaB and stimulates tumour necrosis factor-alpha production. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s TLR5 antibody (ARP31753_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question