website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

TLR2 antibody - C-terminal region (ARP30551_P050)

Description of Target:
TLR2 is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is expressed most abundantly in peripheral blood leukocytes, and mediates host response to Gram-positive bacteria and yeast via stimulation of NF-kappaB. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
Toll-like receptor 2
NCBI Gene Id:
Alias Symbols:
CD282; TIL4
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TLR2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TLR2.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
Toll-like receptor 2
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-TLR2 antibody: synthetic peptide directed towards the C terminal of human TLR2
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
TLR2 antibody - C-terminal region (ARP30551_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Zebrafish: 100%; Rat: 92%; Horse: 92%; Mouse: 91%; Sheep: 91%; Bovine: 91%; Dog: 85%; Goat: 85%; Pig: 79%; Guinea pig: 79%
Species Reactivity:
Zebrafish, Human, Rat, Horse, Sheep, Bovine, Mouse, Dog, Goat, Pig, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-TLR2 antibody
- ARP30551_P050
Peptide Sequence:
Synthetic peptide located within the following region: LEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS
Blocking Peptide:
For anti-TLR2 antibody is Catalog # AAP30551 (Previous Catalog # AAPP01203)
Target Reference:
Niebuhr,M., (2008) Allergy 63 (6), 728-734
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Review: TLR2 Antibody – C terminal region (ARP30551_P050) for human macrophages for immunohistochemistry

Product Review: TLR2 Antibody – C terminal region (ARP30551_P050) for human macrophages for immunohistochemistry

TLR2 Antibody – C terminal region (ARP30551_P050) for human macrophages

TLR2 Antibody – C terminal region (ARP30551_P050) for human macrophages

1) Antibody cataloged

ARP30551_P050 TLR 2 C terminal

2) What application tested?

IFA(primary antibody ARP30551_P050/secondary FITC-conjugated anti-rabbit[green])

3) What species sample type?


4) What cell/tissue type?

Human macrophages

5) What dilution did you use?


6) Overall performance of antibody

very strong and clear signal

Data submitted by: Milan Fiala at UCLA

Ask a Question