website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

TLR2 antibody - C-terminal region (ARP30551_P050)

Description of Target:
TLR2 is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is expressed most abundantly in peripheral blood leukocytes, and mediates host response to Gram-positive bacteria and yeast via stimulation of NF-kappaB. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
Toll-like receptor 2
NCBI Gene Id:
Alias Symbols:
CD282; TIL4
Tissue Tool:
Find tissues and cell lines supported to express TLR2.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Toll-like receptor 2
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-TLR2 antibody: synthetic peptide directed towards the C terminal of human TLR2
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
TLR2 antibody - C-terminal region (ARP30551_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Zebrafish: 100%; Rat: 92%; Horse: 92%; Mouse: 91%; Sheep: 91%; Bovine: 91%; Dog: 85%; Goat: 85%; Pig: 79%; Guinea pig: 79%
Species Reactivity:
Zebrafish, Human, Rat, Horse, Sheep, Bovine, Mouse, Dog, Goat, Pig, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-TLR2 antibody
- ARP30551_P050
Peptide Sequence:
Synthetic peptide located within the following region: LEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS
Blocking Peptide:
For anti-TLR2 antibody is Catalog # AAP30551 (Previous Catalog # AAPP01203)
Key Reference:
Niebuhr,M., (2008) Allergy 63 (6), 728-734
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-TLR2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question