website statistics
Account Login 

Aviva Systems Biology office will be closed for Labor Day - Monday 9/1/2014.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

TLR2 antibody - C-terminal region (ARP30551_P050)

Description of Target:
TLR2 is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is expressed most abundantly in peripheral blood leukocytes, and mediates host response to Gram-positive bacteria and yeast via stimulation of NF-kappaB. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
Toll-like receptor 2
NCBI Gene Id:
Alias Symbols:
CD282; TIL4
Tissue Tool:
Find tissues and cell lines supported to express TLR2.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Toll-like receptor 2
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-TLR2 antibody: synthetic peptide directed towards the C terminal of human TLR2
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
TLR2 antibody - C-terminal region (ARP30551_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Zebrafish: 100%; Rat: 92%; Horse: 92%; Mouse: 91%; Sheep: 91%; Bovine: 91%; Dog: 85%; Goat: 85%; Pig: 79%; Guinea pig: 79%
Species Reactivity:
Zebrafish, Human, Rat, Horse, Sheep, Bovine, Mouse, Dog, Goat, Pig, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-TLR2 antibody
- ARP30551_P050
Peptide Sequence:
Synthetic peptide located within the following region: LEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS
Blocking Peptide:
For anti-TLR2 antibody is Catalog # AAP30551 (Previous Catalog # AAPP01203)
Target Reference:
Niebuhr,M., (2008) Allergy 63 (6), 728-734
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-TLR2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Product Review: TLR2 Antibody – C terminal region (ARP30551_P050) for human macrophages for immunohistochemistry

Product Review: TLR2 Antibody – C terminal region (ARP30551_P050) for human macrophages for immunohistochemistry

TLR2 Antibody – C terminal region (ARP30551_P050) for human macrophages

TLR2 Antibody – C terminal region (ARP30551_P050) for human macrophages

1) Antibody cataloged

ARP30551_P050 TLR 2 C terminal

2) What application tested?

IFA(primary antibody ARP30551_P050/secondary FITC-conjugated anti-rabbit[green])

3) What species sample type?


4) What cell/tissue type?

Human macrophages

5) What dilution did you use?


6) Overall performance of antibody

very strong and clear signal

Data submitted by: Milan Fiala at UCLA

Computational species homology for TLR2 antibody (ARP30551)

Product page for TLR2 antibody (ARP30551)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant LOC100654442 antibody; Loxodonta africana LOC100654442 antibody G3UL46 92%
Alpine field mouse TLR2 antibody; Apodemus alpicola TLR2 antibody E0ZNJ8 84%
American bison TLR2 antibody; Bison bison TLR2 antibody B2LT61 84%
Anderson red-backed vole TLR2 antibody; Eothenomys andersoni TLR2 antibody E0ZNJ0 92%
Bank vole TLR2 antibody; Myodes glareolus TLR2 antibody E0ZNI7 92%
Black flying fox TLR2 antibody; Pteropus alecto TLR2 antibody E2DIE5 92%
Blesbok TLR2 antibody; Damaliscus pygargus phillipsi TLR2 antibody B2LT63 84%
Bornean orangutan TLR2 antibody; Pongo pygmaeus TLR2 antibody B3Y616 100%
Bovine TLR2 antibody; Bos taurus TLR2 antibody B2CRY1 90%
Bovine TLR2 antibody; Bos taurus TLR2 antibody B2CRY0 90%
Bovine TLR2 antibody; Bos taurus TLR2 antibody Q95LA9 84%
Bovine TLR2 antibody; Bos taurus TLR2 antibody G9BH51 84%
Bovine TLR2 antibody; Bos taurus TLR2 antibody F1N720 84%
Bovine TLR2 antibody; Bos taurus TLR2 antibody B2CRY3 81%
Bovine TLR2 antibody; Bos taurus TLR2 antibody B2CRY2 81%
Chicken LOC100858824 antibody; Gallus gallus LOC100858824 antibody C4PC57 84%
Chicken TLR21 antibody; Gallus gallus TLR21 antibody Q9DD78 84%
Chicken TLR22 antibody; Gallus gallus TLR22 antibody Q9DGB6 84%
Chicken TLR2-2 antibody; Gallus gallus TLR2-2 antibody F1P5J3 84%
Chicken TLR2-2 antibody; Gallus gallus TLR2-2 antibody F1NUH0 84%
Chicken TLR2-2 antibody; Gallus gallus TLR2-2 antibody C4PC51 84%
Chimpanzee TLR2 antibody; Pan troglodytes TLR2 antibody B3Y613 100%
Chinese hamster TLR2 antibody; Cricetulus griseus TLR2 antibody Q9R1F8 84%
Common turkey LOC100545365 antibody; Meleagris gallopavo LOC100545365 antibody G1MRA8 84%
Common turkey TLR2A antibody; Meleagris gallopavo TLR2A antibody C7AFF6 84%
Common turkey TLR2B antibody; Meleagris gallopavo TLR2B antibody C7AFF7 84%
Common vole TLR2 antibody; Microtus arvalis TLR2 antibody E0ZNJ5 92%
Crab-eating macaque TLR2 antibody; Macaca fascicularis TLR2 antibody Q95M53 100%
Dog Cfa.15802 antibody; Canis familiaris Cfa.15802 antibody F1PAV5 84%
Dog TLR2 antibody; Canis familiaris TLR2 antibody Q689D1 84%
Dog TLR2 antibody; Canis familiaris TLR2 antibody C0IRA0 84%
Domestic duck TLR2A antibody; Anas platyrhynchos TLR2A antibody C7AFF8 76%
Domestic duck TLR2B antibody; Anas platyrhynchos TLR2B antibody C7AFF9 76%
Domestic water buffalo TLR2 antibody; Bubalus bubalis TLR2 antibody Q2PZH4 84%
Domestic water buffalo TLR2 antibody; Bubalus bubalis TLR2 antibody Q45HJ5 84%
Domestic water buffalo TLR2 antibody; Bubalus bubalis TLR2 antibody E3UZV0 84%
Domestic water buffalo TLR2 antibody; Bubalus bubalis TLR2 antibody E3UZU9 84%
Eurasian water mole TLR2 antibody; Arvicola amphibius TLR2 antibody E0ZNJ7 92%
European bison TLR2 antibody; Bison bonasus TLR2 antibody B0LUW0 90%
European bison TLR2 antibody; Bison bonasus TLR2 antibody B0LUV9 90%
European harvest mouse TLR2 antibody; Micromys minutus TLR2 antibody E0ZNK1 75%
European snow vole TLR2 antibody; Chionomys nivalis TLR2 antibody E0ZNJ3 92%
European woodmouse TLR2 antibody; Apodemus sylvaticus TLR2 antibody E0ZNK0 84%
Giant panda LOC100465129 antibody; Ailuropoda melanoleuca LOC100465129 antibody D2GXT0 76%
Giraffe TLR2 antibody; Giraffa camelopardalis TLR2 antibody B2LT64 92%
Goat TLR2 antibody; Capra hircus TLR2 antibody Q0GC71 84%
Goat TLR2 antibody; Capra hircus TLR2 antibody D6PW90 84%
Gray red-backed vole TLR2 antibody; Myodes rufocanus TLR2 antibody E0ZNJ1 92%
Gray short-tailed opossum LOC100024558 antibody; Monodelphis domestica LOC100024558 antibody F6UTM1 90%
Guinea pig LOC100717682 antibody; Cavia porcellus LOC100717682 antibody H0WAE9 78%
Hispid cotton rat TLR2 antibody; Sigmodon hispidus TLR2 antibody B7UCR3 92%
Hokkaido red-backed vole TLR2 antibody; Myodes rex TLR2 antibody E0ZNJ2 92%
Horse ECA.12774 antibody; Equus caballus ECA.12774 antibody F6PP31 92%
Horse TLR2 antibody; Equus caballus TLR2 antibody Q6T752 92%
Human TLR2 antibody; Homo sapiens TLR2 antibody O60603 100%
Human TLR2 antibody; Homo sapiens TLR2 antibody D1CS49 100%
Human TLR2 antibody; Homo sapiens TLR2 antibody D1CS48 100%
Human TLR2 antibody; Homo sapiens TLR2 antibody D1CS45 100%
Human TLR2 antibody; Homo sapiens TLR2 antibody C6KIA9 100%
Human TLR2 antibody; Homo sapiens TLR2 antibody C6KIA6 100%
Human TLR2 antibody; Homo sapiens TLR2 antibody B3KWR9 100%
Hybrid cattle TLR2 antibody; Bos indicus x Bos taurus TLR2 antibody B5T269 84%
Hybrid cattle TLR2 antibody; Bos indicus x Bos taurus TLR2 antibody B5T268 84%
Hybrid cattle TLR2 antibody; Bos indicus x Bos taurus TLR2 antibody B5T263 84%
Ibex TLR2 antibody; Capra ibex TLR2 antibody B2LT62 84%
Japanese macaque TLR2 antibody; Macaca fuscata TLR2 antibody F1T1Q7 100%
Little brown bat TLR2 antibody; Myotis lucifugus TLR2 antibody G1Q8E0 84%
Lowland gorilla TLR2 antibody; Gorilla gorilla gorilla TLR2 antibody B3Y615 100%
Lowland gorilla TLR2 antibody; Gorilla gorilla gorilla TLR2 antibody G3QKN2 100%
Mouse Tlr2 antibody; Mus musculus Tlr2 antibody Q811T5 90%
Mouse TLR2 antibody; Mus musculus TLR2 antibody Q9QUN7 84%
Mouse Tlr2 antibody; Mus musculus Tlr2 antibody Q8K3D9 84%
Mouse Tlr2 antibody; Mus musculus Tlr2 antibody G3X8Y8 84%
Nilgai TLR2 antibody; Boselaphus tragocamelus TLR2 antibody Q2V897 84%
Northern red-backed vole TLR2 antibody; Clethrionomys rutilus TLR2 antibody E0ZNI8 92%
Northern white-cheeked gibbon LOC100604724 antibody; Nomascus leucogenys LOC100604724 antibody G1SB95 100%
Pan troglodytes verus TLR2 antibody D7NVH7 100%
Pan troglodytes verus TLR2 antibody D7NVH4 100%
Pan troglodytes verus TLR2 antibody D7NVH3 100%
Pan troglodytes verus TLR2 antibody D7NVG8 100%
Pig sTLR2 antibody; Sus scrofa sTLR2 antibody Q5DX22 78%
Pig TLR2 antibody; Sus scrofa TLR2 antibody Q6TN21 78%
Pig TLR2 antibody; Sus scrofa TLR2 antibody Q5DX20 78%
Pig TLR2 antibody; Sus scrofa TLR2 antibody Q59HI8 78%
Pig TLR2 antibody; Sus scrofa TLR2 antibody D3JEM3 78%
Pig TLR-2 antibody; Sus scrofa TLR-2 antibody Q76L24 78%
Pygmy chimpanzee TLR2 antibody; Pan paniscus TLR2 antibody B3Y614 100%
Rat Tlr2 antibody; Rattus norvegicus Tlr2 antibody Q6YGU2 85%
Rat Tlr2 antibody; Rattus norvegicus Tlr2 antibody E9PTD9 85%
Rhesus macaque Mmu.3812 antibody; Macaca mulatta Mmu.3812 antibody F7CD54 100%
Rhesus macaque TLR2 antibody; Macaca mulatta TLR2 antibody B3Y618 100%
Rhesus macaque TLR2 antibody; Macaca mulatta TLR2 antibody Q5MXJ1 100%
Sheep TLR2 antibody; Ovis aries TLR2 antibody A7L824 90%
Sheep TLR2 antibody; Ovis aries TLR2 antibody rget='_blank'>A7L823 81%
Sheep TLR2 antibody; Ovis aries TLR2 antibody A7L822 81%
Sheep TLR2 antibody; Ovis aries TLR2 antibody Q09I12 76%
Short-tailed field vole TLR2 antibody; Microtus agrestis TLR2 antibody E0ZNJ4 92%
Sika deer TLR2 antibody; Cervus nippon TLR2 antibody F1CGS8 84%
Small-eared galago TLR2 antibody; Otolemur garnettii TLR2 antibody H0XHK1 91%
Smith red-backed vole TLR2 antibody; Eothenomys smithii TLR2 antibody E0ZNI9 85%
Springbok TLR2 antibody; Antidorcas marsupialis TLR2 antibody B2LT60 84%
Tasmanian devil TLR2 antibody; Sarcophilus harrisii TLR2 antibody G3VZD3 92%
Tundra vole TLR2 antibody; Microtus oeconomus TLR2 antibody E0ZNJ6 92%
Western clawed frog tlr2 antibody; Xenopus tropicalis tlr2 antibody F7C313 84%
White-tufted-ear marmoset LOC100404611 antibody; Callithrix jacchus LOC100404611 antibody F7HQL3 92%
Yellow-necked field mouse TLR2 antibody; Apodemus flavicollis TLR2 antibody E0ZNJ9 84%
Zebra finch LOC100222593 antibody; Taeniopygia guttata LOC100222593 antibody H0Z431 76%
Zebra finch TLR2B antibody; Taeniopygia guttata TLR2B antibody H0Z427 76%
Zebu TLR2 antibody; Bos indicus TLR2 antibody B5T267 84%
Ask a Question