STAT6 antibody - C-terminal region (ARP31048_P050)

Catalog#: ARP31048_P050

• Size: 50ug

Human HeLa

Human Tonsil

Human Testis

Human Prostate

Human Kidney

• Description of Target: Full-length human STAR6 (NP_003144) was expressed in E.coli as inclusion body and purified after protein refolding for mouse immunization. Clone 5B1 shows excellent western blot detection of endogenous STAT6 using ACHN cell lysate.The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Gene Symbol: STAT6
• Official Gene Full Name: Signal transducer and activator of transcription 6, interleukin-4 induced
• Alias Symbols: D12S1644; IL-4-STAT; STAT6B; STAT6C
• Protein Accession#: NP_003144
• Nucleotide Accession#: NM_003153
• Swissprot Id: P42226
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 847
• Molecular Weight: 94kDa
• Application: WB, IHC
• Partner Proteins: APBB1, CASP8, COIL, NFE4, RNF2, TFCP2, APBB1, CASP8, NFE4, RNF2
• Immunogen: The immunogen for anti-STAT6 antibody: synthetic peptide directed towards the C terminal of human STAT6
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: NLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQM
• Blocking Peptide: For anti-STAT6 antibody is Catalog # AAP31048 (Previous Catalog # AAPP24027)
• Additional Information: IHC Information: Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE)
  IHC Information: Human Prostate: Formalin-Fixed, Paraffin-Embedded (FFPE)
  IHC Information: Human Testis: Formalin-Fixed, Paraffin-Embedded (FFPE)
  IHC Information: Human Tonsil: Formalin-Fixed, Paraffin-Embedded (FFPE)
• Key Reference: Li,B.H., (2008) Biochem. Biophys. Res. Commun. 369 (2), 554-560
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-STAT6 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.