ST14 Antibody - C-terminal region (ARP48056_P050)

Catalog No: ARP48056_P050

WB Suggested Anti-ST14 Antibody Titration: 0.25ug/ml
Positive Control: DLD1 cell lysateST14 is strongly supported by BioGPS gene expression data to be expressed in Human DLD1 cells

Human kidney

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Lane A: Marker. Lane B: DLD1 cell lysate. Antibody concentration: 0.25 ug/ml. Gel concentration: 12%.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ST14
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQIT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ST14 (ARP48056_P050) antibody is Catalog # AAP48056 (Previous Catalog # AAPS20911)
• Sample Type Confirmation:

  ST14 is strongly supported by BioGPS gene expression data to be expressed in DLD1

Target Info

• Gene Symbol: ST14
• Gene Full Name: Suppression of tumorigenicity 14 (colon carcinoma)
• Alias Symbols: HAI, CAP3, MTSP1, SNC19, ARCI11, MT-SP1, PRSS14, TADG15, TMPRSS14
• NCBI Gene Id: 6768
• Protein Name: Suppressor of tumorigenicity 14 protein
• Description of Target: ST14 is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis.
• Uniprot ID: Q9Y5Y6
• Protein Accession #: AAH18146
• Nucleotide Accession #: NM_021978
• Protein Size (# AA): 855
• Molecular Weight: 95kDa
• Protein Interactions: UBC; RGS16; PDGFC; CDCP1; SPINT1; F2RL1; PLAU; HGF;