SPPL2B Antibody - N-terminal region (ARP44989_P050)

Catalog No: ARP44989_P050

WB Suggested Anti-SPPL2B Antibody Titration: 1 ug/ml
Positive Control: Jurkat cell lysateSPPL2B is supported by BioGPS gene expression data to be expressed in Jurkat

Human kidney

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Jurkat cell lysate. Antibody concentration: 1.0 ug/ml. Gel concentration: 8%.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SPPL2B
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SPPL2B (ARP44989_P050) antibody is Catalog # AAP44989 (Previous Catalog # AAPP26068)
• Sample Type Confirmation:

  SPPL2B is supported by BioGPS gene expression data to be expressed in Jurkat

• Publications:

  Del Campo, M. et al. BRI2-BRICHOS is increased in human amyloid plaques in early stages of Alzheimer’s disease. Neurobiol. Aging 35, 1596-604 (2014). 24524963

Target Info

• Gene Symbol: SPPL2B
• Gene Full Name: Signal peptide peptidase like 2B
• Alias Symbols: IMP4, PSH4, PSL1, IMP-4
• NCBI Gene Id: 56928
• Protein Name: Signal peptide peptidase-like 2B
• Description of Target: SPPL2B is a member of the GXGD family of aspartic proteases. The GXGD proteases are transmembrane proteins with two conserved catalytic motifs localized within the membrane-spanning regions. This enzyme localizes to endosomes, lysosomes, and the plasma membrane. It cleaves the transmembrane domain of tumor necrosis factor alpha to release the intracellular domain, which triggers cytokine expression in the innate and adaptive immunity pathways.
• Uniprot ID: Q8TCT7-4
• Protein Accession #: NP_001070706
• Nucleotide Accession #: NM_001077238
• Protein Size (# AA): 511
• Molecular Weight: 56kDa