SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP45752_T100
Price: $0.00
SKU
ARP45752_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SOD1 (ARP45752_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Jurkat cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 15%.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SOD1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE
Concentration1.0 mg/ml
Blocking PeptideFor anti-SOD1 (ARP45752_T100) antibody is Catalog # AAP45752 (Previous Catalog # AAPP26705)
Sample Type Confirmation

SOD1 is supported by BioGPS gene expression data to be expressed in Jurkat

ReferenceHays,A.P., J. Neurol. Sci. 242 (1-2), 67-69 (2006)
Gene SymbolSOD1
Gene Full NameSuperoxide dismutase 1, soluble
Alias SymbolsALS, SOD, ALS1, IPOA, STAHP, hSod1, HEL-S-44, homodimer
NCBI Gene Id6647
Protein NameSuperoxide dismutase [Cu-Zn]
Description of TargetSOD1 binds copper and zinc ions and is one of two isozymes responsible for destroying free superoxide radicals in the body. This isozyme is a soluble cytoplasmic protein, acting as a homodimer to convert naturally-occuring but harmful superoxide radicals to molecular oxygen and hydrogen peroxide. The other isozyme is a mitochondrial protein. Mutations in its gene have been implicated as causes of familial amyotrophic lateral sclerosis.The protein encoded by this gene binds copper and zinc ions and is one of two isozymes responsible for destroying free superoxide radicals in the body. The encoded isozyme is a soluble cytoplasmic protein, acting as a homodimer to convert naturally-occuring but harmful superoxide radicals to molecular oxygen and hydrogen peroxide. The other isozyme is a mitochondrial protein. Mutations in this gene have been implicated as causes of familial amyotrophic lateral sclerosis. Rare transcript variants have been reported for this gene.
Uniprot IDP00441
Protein Accession #NP_000445
Nucleotide Accession #NM_000454
Protein Size (# AA)154
Molecular Weight16kDa
Protein InteractionsSOD1; CRYAB; UBC; SMAD2; HDAC6; GSH1; OPTN; PRDX5; AHCYL1; TIAL1; PRDX2; SPTBN1; SOD2; PPP2CA; PPIA; PLS3; PRDX1; NME2; NME1; Hspa4l; Hspa4; Hspa2; Hspa1b; Hsph1; Dnaja1; Hspa8; Hspa5; Ccs; UBE3A; COMMD1; Stub1; SUMO4; DYNLT1; AMFR; MARCH5; RNF19A; PSMD4;
  1. What is the species homology for "SOD1 Antibody - N-terminal region (ARP45752_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "SOD1 Antibody - N-terminal region (ARP45752_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SOD1 Antibody - N-terminal region (ARP45752_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SOD1 Antibody - N-terminal region (ARP45752_T100)"?

    This target may also be called "ALS, SOD, ALS1, IPOA, STAHP, hSod1, HEL-S-44, homodimer" in publications.

  5. What is the shipping cost for "SOD1 Antibody - N-terminal region (ARP45752_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SOD1 Antibody - N-terminal region (ARP45752_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SOD1 Antibody - N-terminal region (ARP45752_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "16kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SOD1 Antibody - N-terminal region (ARP45752_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SOD1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SOD1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SOD1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SOD1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SOD1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SOD1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SOD1 Antibody - N-terminal region (ARP45752_T100)
Your Rating
We found other products you might like!