- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-SMAD1 (ARP38692_T100) antibody |
---|
Tested Species Reactivity | Human, Mouse |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IHC, WB |
Additional Information | IHC Information: Transfected 293T cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%. |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SMAD1 |
Purification | Protein A purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Peptide Sequence | Synthetic peptide located within the following region: MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEE |
Concentration | 1.0 mg/ml |
Blocking Peptide | For anti-SMAD1 (ARP38692_T100) antibody is Catalog # AAP38692 (Previous Catalog # AAPP20881) |
Specificity | This antibody reacts with SMAD1 + SMAD5 and to a lesser extent, SMAD8. |
Reference | Jadlowiec,J.A., (2006) J. Biol. Chem. 281 (9), 5341-5347 |
Gene Symbol | SMAD1 |
---|---|
Gene Full Name | SMAD family member 1 |
Alias Symbols | BSP1, JV41, BSP-1, JV4-1, MADH1, MADR1 |
NCBI Gene Id | 4086 |
Protein Name | Mothers against decapentaplegic homolog 5 |
Description of Target | SMAD1 belongs to the SMAD family. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. SMAD1 mediates the signals of the bone morphogenetic proteins (BMPs), which are involved in a range of biological activities including cell growth, apoptosis, morphogenesis, development and immune responses. In response to BMP ligands, SMAD1 can be phosphorylated and activated by the BMP receptor kinase. The phosphorylated form of SMAD1 forms a complex with SMAD4, which is important for its function in the transcription regulation. SMAD1 is a target for SMAD-specific E3 ubiquitin ligases, such as SMURF1 and SMURF2, and undergoes ubiquitination and proteasome-mediated degradation.The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signals of the bone morphogenetic proteins (BMPs), which are involved in a range of biological activities including cell growth, apoptosis, morphogenesis, development and immune responses. In response to BMP ligands, this protein can be phosphorylated and activated by the BMP receptor kinase. The phosphorylated form of this protein forms a complex with SMAD4, which is important for its function in the transcription regulation. This protein is a target for SMAD-specific E3 ubiquitin ligases, such as SMURF1 and SMURF2, and undergoes ubiquitination and proteasome-mediated degradation. Alternatively spliced transcript variants encoding the same protein have been observed. |
Uniprot ID | Q99717 |
Protein Accession # | NP_005891 |
Nucleotide Accession # | NM_005900 |
Protein Size (# AA) | 465 |
Molecular Weight | 52kDa |
Protein Interactions | HDAC1; SMURF1; WDR77; AR; UBC; ACVRL1; SMAD4; LEMD3; MAPK1; GSK3B; ZNF521; ZNF423; AKR1B1; AP2A2; PIAS4; ZDHHC3; HBP1; IRF2BP1; SF3B1; MGA; ZNF510; ICK; GMEB1; ZEB2; PUM1; PIGQ; PIAS1; TTF2; KMT2D; ZNF76; XPC; TTF1; SOX5; SNRNP70; SMAD3; SMAD2; SMAD1; INP |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "SMAD1 Antibody - N-terminal region (ARP38692_T100)"?
The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".
-
How long will it take to receive "SMAD1 Antibody - N-terminal region (ARP38692_T100)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "SMAD1 Antibody - N-terminal region (ARP38692_T100)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "SMAD1 Antibody - N-terminal region (ARP38692_T100)"?
This target may also be called "BSP1, JV41, BSP-1, JV4-1, MADH1, MADR1" in publications.
-
What is the shipping cost for "SMAD1 Antibody - N-terminal region (ARP38692_T100)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "SMAD1 Antibody - N-terminal region (ARP38692_T100)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "SMAD1 Antibody - N-terminal region (ARP38692_T100)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "52kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "SMAD1 Antibody - N-terminal region (ARP38692_T100)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "SMAD1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "SMAD1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "SMAD1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "SMAD1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "SMAD1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "SMAD1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.