SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP45638_P050
Price: $0.00
SKU
ARP45638_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-RXRB (ARP45638_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human RXRB
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: PGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGA
Concentration0.5 mg/ml
Blocking PeptideFor anti-RXRB (ARP45638_P050) antibody is Catalog # AAP45638 (Previous Catalog # AAPP11921)
Sample Type Confirmation

RXRB is strongly supported by BioGPS gene expression data to be expressed in Jurkat

ReferenceChang,S.C., (er) Carcinogenesis (2008) In press
Gene SymbolRXRB
Gene Full NameRetinoid X receptor, beta
Alias SymbolsNR2B2, DAUDI6, RCoR-1, H-2RIIBP
NCBI Gene Id6257
Protein NameRetinoic acid receptor RXR-beta
Description of TargetRXRB is a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). This receptor forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). This receptor forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. The gene lies within the major histocompatibility complex (MHC) class II region on chromosome 6. An alternatively spliced transcript variant has been described, but its full length sequence has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). This receptor forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. The gene lies within the major histocompatibility complex (MHC) class II region on chromosome 6. An alternatively spliced transcript variant has been described, but its full length sequence has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP28702
Protein Accession #NP_068811
Nucleotide Accession #NM_021976
Protein Size (# AA)533
Molecular Weight57kDa
Protein InteractionsNR1H3; RARB; UBC; PTMS; CACNA1B; SPOP; RARA; ZDHHC12; VDR; GRIP1; SRA1; MED1; Cebpb; SUMO2; NR1I2; NR1H2; NR2C2; THRB; SRC; RARG; PPARG; PPARD; NR4A2; MAP4; GTF2H1; NR3C1; TAF11; THRA; TACC2; AKAP13; NR0B2; NR2E3; NCOA1; NRIP1; NCOA3; RXRB;
  1. What is the species homology for "RXRB Antibody - N-terminal region (ARP45638_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "RXRB Antibody - N-terminal region (ARP45638_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RXRB Antibody - N-terminal region (ARP45638_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RXRB Antibody - N-terminal region (ARP45638_P050)"?

    This target may also be called "NR2B2, DAUDI6, RCoR-1, H-2RIIBP" in publications.

  5. What is the shipping cost for "RXRB Antibody - N-terminal region (ARP45638_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RXRB Antibody - N-terminal region (ARP45638_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RXRB Antibody - N-terminal region (ARP45638_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "57kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RXRB Antibody - N-terminal region (ARP45638_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "RXRB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RXRB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RXRB"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RXRB"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RXRB"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RXRB"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RXRB Antibody - N-terminal region (ARP45638_P050)
Your Rating
We found other products you might like!