SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP34099_P050
Price: $0.00
SKU
ARP34099_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PTGER3 (ARP34099_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PTGER3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: QMRKRRLREQLICSLQNSQIQRATAHCGQVQTYRVLNREEMEVLVSSINV
Concentration0.5 mg/ml
Blocking PeptideFor anti-PTGER3 (ARP34099_P050) antibody is Catalog # AAP34099 (Previous Catalog # AAPP05308)
Enhanced Validation
WBY
SPR
YCHAROS
ReferencePatwardhan,A.M., (2008) J. Dent. Res. 87 (3), 262-266
Gene SymbolPTGER3
Gene Full NameProstaglandin E receptor 3 (subtype EP3)
Alias SymbolsEP3, EP3e, EP3-I, EP3-II, EP3-IV, EP3-VI, PGE2-R, EP3-III, lnc003875
NCBI Gene Id5733
Protein NameProstaglandin E receptor 3 (Subtype EP3) EMBL CAI20225.1
Description of TargetThe specific function of this protein remains unknown.The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor may have many biological functions, which involve digestion, nervous system, kidney reabsorption, and uterine contraction activities. Studies of the mouse counterpart suggest that this receptor may also mediate adrenocorticotropic hormone response as well as fever generation in response to exogenous and endogenous stimuli. Multiple alternatively spliced transcript variants encoding eight distinct isoforms have been reported.
Uniprot IDB1AK19
Protein Accession #NP_942011
Nucleotide Accession #NM_198718
Protein Size (# AA)418
Molecular Weight57 kDa
Protein InteractionsNOTCH2NL; INCA1; KRTAP10-3; KRTAP10-8; KRTAP10-9; KRTAP10-7; TRIM42; MGAT5B; KRT40; CCDC33; ADAMTSL4; EFEMP2; RGS17; SPRY2; KRT38; RGS20; TCF4; REL; MEOX2; KRT31; CDA; GHRL; MKLN1; PTGER1;
  1. What is the species homology for "PTGER3 Antibody - middle region (ARP34099_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "PTGER3 Antibody - middle region (ARP34099_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PTGER3 Antibody - middle region (ARP34099_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PTGER3 Antibody - middle region (ARP34099_P050)"?

    This target may also be called "EP3, EP3e, EP3-I, EP3-II, EP3-IV, EP3-VI, PGE2-R, EP3-III, lnc003875" in publications.

  5. What is the shipping cost for "PTGER3 Antibody - middle region (ARP34099_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PTGER3 Antibody - middle region (ARP34099_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PTGER3 Antibody - middle region (ARP34099_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "57 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PTGER3 Antibody - middle region (ARP34099_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PTGER3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PTGER3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PTGER3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PTGER3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PTGER3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PTGER3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PTGER3 Antibody - middle region (ARP34099_P050)
Your Rating
We found other products you might like!