website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

PTGER3 antibody - middle region (ARP34099_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
PTGER3
NCBI Gene Id:
5733
Official Gene Full Name:
Prostaglandin E receptor 3 (subtype EP3)
Protein Name:
Prostaglandin E receptor 3 (Subtype EP3) EMBL CAI20225.1
Swissprot Id:
B1AK19
Protein Accession #:
NP_942011
Nucleotide Accession #:
NM_198718
Alias Symbols:
EP3, EP3-I, EP3-II, EP3-III, EP3-IV, EP3e, MGC141828, MGC141829, MGC27302, PGE2-R
Description of Target:
The specific function of this protein remains unknown.The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor may have many biological functions, which involve digestion, nervous system, kidney reabsorption, and uterine contraction activities. Studies of the mouse counterpart suggest that this receptor may also mediate adrenocorticotropic hormone response as well as fever generation in response to exogenous and endogenous stimuli. Multiple alternatively spliced transcript variants encoding eight distinct isoforms have been reported.
Protein Size (# AA):
418
Molecular Weight:
47kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PTGER3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PTGER3.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human PTGER3
Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-PTGER3 (ARP34099_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QMRKRRLREQLICSLQNSQIQRATAHCGQVQTYRVLNREEMEVLVSSINV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
NOTCH2NL; INCA1; KRTAP10-3; KRTAP10-8; KRTAP10-9; KRTAP10-7; TRIM42; MGAT5B; KRT40; CCDC33; ADAMTSL4; EFEMP2; RGS17; SPRY2; KRT38; RGS20; TCF4; REL; MEOX2; KRT31; CDA; GHRL; MKLN1; PTGER1;
Blocking Peptide:
For anti-PTGER3 (ARP34099_P050) antibody is Catalog # AAP34099 (Previous Catalog # AAPP05308)
Datasheets / Downloads:
Printable datasheet for anti-PTGER3 (ARP34099_P050) antibody
Target Reference:
Patwardhan,A.M., (2008) J. Dent. Res. 87 (3), 262-266

Product Protocols: PTGER3 antibody tested with Human Ht1080 Cells (ARP34099_P050)

Aviva Systems Biology is the original manufacturer of this PTGER3 antibody (ARP34099_P050)

Click here to view the PTGER3 antibody Western Blot Protocol

Product Datasheet Link: PTGER3 antibody (ARP34099_P050)

WB Suggested Anti-PTGER3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HT1080

Western Blot image:


Description of Target: The specific function of this protein remains unknown.The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor may have many biological functions, which involve digestion, nervous system, kidney reabsorption, and uterine contraction activities. Studies of the mouse counterpart suggest that this receptor may also mediate adrenocorticotropic hormone response as well as fever generation in response to exogenous and endogenous stimuli. Multiple alternatively spliced transcript variants encoding eight distinct isoforms have been reported.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s PTGER3 antibody (ARP34099_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question