website statistics
Account Login 

Aviva Systems Biology office will be closed for Christmas and New Year holidays - 12/24/2014, 12/25/2014 and 1/1/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

PTGER3 antibody - middle region (ARP34099_P050)

Receive a free positive control (AHL013) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
The specific function of this protein remains unknown.The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor may have many biological functions, which involve digestion, nervous system, kidney reabsorption, and uterine contraction activities. Studies of the mouse counterpart suggest that this receptor may also mediate adrenocorticotropic hormone response as well as fever generation in response to exogenous and endogenous stimuli. Multiple alternatively spliced transcript variants encoding eight distinct isoforms have been reported.
Gene Symbol:
PTGER3
Official Gene Full Name:
Prostaglandin E receptor 3 (subtype EP3)
NCBI Gene Id:
5733
Alias Symbols:
EP3; EP3-I; EP3-II; EP3-III; EP3-IV; EP3e; MGC141828; MGC141829; MGC27302; PGE2-R
Tissue Tool:
Find tissues and cell lines supported to express PTGER3.
Protein Accession #:
NP_942011
Nucleotide Accession#:
NM_198718
Swissprot Id:
B1AK19
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Prostaglandin E receptor 3 (Subtype EP3) EMBL CAI20225.1
Protein Size (# AA):
418
Molecular Weight:
47kDa
Application:
WB
Partner Proteins:
PTGER1
Immunogen:
The immunogen for anti-PTGER3 antibody: synthetic peptide directed towards the middle region of human PTGER3
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
PTGER3 antibody - middle region (ARP34099_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Human
Datasheets / Downloads:
Printable datasheet for
anti-PTGER3 antibody
- ARP34099_P050
Peptide Sequence:
Synthetic peptide located within the following region: QMRKRRLREQLICSLQNSQIQRATAHCGQVQTYRVLNREEMEVLVSSINV
Blocking Peptide:
For anti-PTGER3 antibody is Catalog # AAP34099 (Previous Catalog # AAPP05308)
Target Reference:
Patwardhan,A.M., (2008) J. Dent. Res. 87 (3), 262-266
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-PTGER3 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for PTGER3 antibody (ARP34099)

Product page for PTGER3 antibody (ARP34099)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Human PTGER3 antibody; Homo sapiens PTGER3 antibody B1AK19 100%

Product Protocols: PTGER3 antibody tested with Human Ht1080 Cells (ARP34099_P050)

Aviva Systems Biology is the original manufacturer of this PTGER3 antibody (ARP34099_P050)

Click here to view the PTGER3 antibody Western Blot Protocol

Product Datasheet Link: PTGER3 antibody (ARP34099_P050)

WB Suggested Anti-PTGER3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HT1080

Western Blot image:


Description of Target: The specific function of this protein remains unknown.The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor may have many biological functions, which involve digestion, nervous system, kidney reabsorption, and uterine contraction activities. Studies of the mouse counterpart suggest that this receptor may also mediate adrenocorticotropic hormone response as well as fever generation in response to exogenous and endogenous stimuli. Multiple alternatively spliced transcript variants encoding eight distinct isoforms have been reported.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s PTGER3 antibody (ARP34099_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question