website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

PTGER3 antibody - middle region (ARP34099_P050)

Receive a free positive control (AHL013) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
The specific function of this protein remains unknown.The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor may have many biological functions, which involve digestion, nervous system, kidney reabsorption, and uterine contraction activities. Studies of the mouse counterpart suggest that this receptor may also mediate adrenocorticotropic hormone response as well as fever generation in response to exogenous and endogenous stimuli. Multiple alternatively spliced transcript variants encoding eight distinct isoforms have been reported.
Gene Symbol:
Official Gene Full Name:
Prostaglandin E receptor 3 (subtype EP3)
NCBI Gene Id:
Alias Symbols:
EP3; EP3-I; EP3-II; EP3-III; EP3-IV; EP3e; MGC141828; MGC141829; MGC27302; PGE2-R
Tissue Tool:
Find tissues and cell lines supported to express PTGER3.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Prostaglandin E receptor 3 (Subtype EP3) EMBL CAI20225.1
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-PTGER3 antibody: synthetic peptide directed towards the middle region of human PTGER3
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
PTGER3 antibody - middle region (ARP34099_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Datasheets / Downloads:
Printable datasheet for
anti-PTGER3 antibody
- ARP34099_P050
Peptide Sequence:
Synthetic peptide located within the following region: QMRKRRLREQLICSLQNSQIQRATAHCGQVQTYRVLNREEMEVLVSSINV
Blocking Peptide:
For anti-PTGER3 antibody is Catalog # AAP34099 (Previous Catalog # AAPP05308)
Key Reference:
Patwardhan,A.M., (2008) J. Dent. Res. 87 (3), 262-266
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-PTGER3 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question