website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

PTGER3 antibody - middle region (ARP34099_P050)

Receive a free positive control (AHL013) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
The specific function of this protein remains unknown.The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor may have many biological functions, which involve digestion, nervous system, kidney reabsorption, and uterine contraction activities. Studies of the mouse counterpart suggest that this receptor may also mediate adrenocorticotropic hormone response as well as fever generation in response to exogenous and endogenous stimuli. Multiple alternatively spliced transcript variants encoding eight distinct isoforms have been reported.
Gene Symbol:
Official Gene Full Name:
Prostaglandin E receptor 3 (subtype EP3)
NCBI Gene Id:
Alias Symbols:
EP3; EP3-I; EP3-II; EP3-III; EP3-IV; EP3e; MGC141828; MGC141829; MGC27302; PGE2-R
Tissue Tool:
Find tissues and cell lines supported to express PTGER3.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Prostaglandin E receptor 3 (Subtype EP3) EMBL CAI20225.1
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-PTGER3 antibody: synthetic peptide directed towards the middle region of human PTGER3
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
PTGER3 antibody - middle region (ARP34099_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Datasheets / Downloads:
Printable datasheet for
anti-PTGER3 antibody
- ARP34099_P050
Peptide Sequence:
Synthetic peptide located within the following region: QMRKRRLREQLICSLQNSQIQRATAHCGQVQTYRVLNREEMEVLVSSINV
Blocking Peptide:
For anti-PTGER3 antibody is Catalog # AAP34099 (Previous Catalog # AAPP05308)
Target Reference:
Patwardhan,A.M., (2008) J. Dent. Res. 87 (3), 262-266
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: PTGER3 antibody tested with Human Ht1080 Cells (ARP34099_P050)

Aviva Systems Biology is the original manufacturer of this PTGER3 antibody (ARP34099_P050)

Click here to view the PTGER3 antibody Western Blot Protocol

Product Datasheet Link: PTGER3 antibody (ARP34099_P050)

WB Suggested Anti-PTGER3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HT1080

Western Blot image:

Description of Target: The specific function of this protein remains unknown.The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor may have many biological functions, which involve digestion, nervous system, kidney reabsorption, and uterine contraction activities. Studies of the mouse counterpart suggest that this receptor may also mediate adrenocorticotropic hormone response as well as fever generation in response to exogenous and endogenous stimuli. Multiple alternatively spliced transcript variants encoding eight distinct isoforms have been reported.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s PTGER3 antibody (ARP34099_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question