PTGDS Antibody - N-terminal region (ARP48154_P050)

Catalog No: ARP48154_P050

WB Suggested Anti-PTGDS Antibody Titration: 1 ug/ml
Positive Control: HepG2 cell lysate

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

Human kidney

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: HepG2 cell lysate. Antibody concentration: 1.0 ug/ml. Gel concentration: 12%.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PTGDS
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 86%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 100%; Rabbit: 80%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLAS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PTGDS (ARP48154_P050) antibody is Catalog # AAP48154 (Previous Catalog # AAPP28665)
• Enhanced Validation:

  SPR Affinity Characterization

• Reference: Lovell,M.A., (2008) Neurology 70 (23), 2212-2218

Target Info

• Gene Symbol: PTGDS
• Gene Full Name: Prostaglandin D2 synthase 21kDa (brain)
• Alias Symbols: PDS, PGD2, PGDS, LPGDS, PGDS2, L-PGDS
• NCBI Gene Id: 5730
• Protein Name: Prostaglandin-H2 D-isomerase
• Description of Target: PTGDS is a glutathione-independent prostaglandin D synthase that catalyzes the conversion of prostaglandin H2 (PGH2) to postaglandin D2 (PGD2). PGD2 functions as a neuromodulator as well as a trophic factor in the central nervous system. PGD2 is also involved in smooth muscle contraction/relaxation and is a potent inhibitor of platelet aggregation.The protein encoded by this gene is a glutathione-independent prostaglandin D synthase that catalyzes the conversion of prostaglandin H2 (PGH2) to postaglandin D2 (PGD2). PGD2 functions as a neuromodulator as well as a trophic factor in the central nervous system. PGD2 is also involved in smooth muscle contraction/relaxation and is a potent inhibitor of platelet aggregation. This gene is preferentially expressed in brain. Studies with transgenic mice overexpressing this gene suggest that this gene may be also involved in the regulation of non-rapid eye movement sleep. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P41222
• Protein Accession #: NP_000945
• Nucleotide Accession #: NM_000954
• Protein Size (# AA): 190
• Molecular Weight: 21 kDa
• Protein Interactions: PTGDR; HSP90AA1; KRTAP10-3; KRTAP10-7; Hk3; Hk2; ARRB2; ARR3; RARRES3; CAPN1; PTGDS; MLH1; BCAT2; ATXN1; SHBG; CACNA1A; EGFR; PTGFR; PTGER2; PTGER1;