SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP46079_P050
Price: $0.00
SKU
ARP46079_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PPAT (ARP46079_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 0.25 ug/ml. Gel concentration: 12%.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PPAT
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Rabbit: 93%; Rat: 79%
Peptide SequenceSynthetic peptide located within the following region: VTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKC
Concentration0.5 mg/ml
Blocking PeptideFor anti-PPAT (ARP46079_P050) antibody is Catalog # AAP46079 (Previous Catalog # AAPS17401)
Sample Type Confirmation

PPAT is supported by BioGPS gene expression data to be expressed in HepG2

Enhanced Validation
Relative Expression (Western Blot) Avivasheild
ReferenceBera,A.K., (1999) J. Biol. Chem. 274 (51), 36498-36504
Gene SymbolPPAT
Gene Full NamePhosphoribosyl pyrophosphate amidotransferase
Alias SymbolsGPAT, PRAT, ATASE
NCBI Gene Id5471
Protein NameAmidophosphoribosyltransferase
Description of TargetPPAT is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. Its gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.The protein encoded by this gene is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. This gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.
Uniprot IDQ06203
Protein Accession #NP_002694
Nucleotide Accession #NM_002703
Protein Size (# AA)517
Molecular Weight57 kDa
Protein InteractionsFAM96B; CIAO1; FAM114A1; PARVA; CARM1; RANBP3; TROVE2; RSU1; MEA1; ILK; HSPA4; GART; CARS; MMS19; EPT1; ATXN1; SMURF1; MCM3; UBC;
  1. What is the species homology for "PPAT Antibody - N-terminal region (ARP46079_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "PPAT Antibody - N-terminal region (ARP46079_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PPAT Antibody - N-terminal region (ARP46079_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PPAT Antibody - N-terminal region (ARP46079_P050)"?

    This target may also be called "GPAT, PRAT, ATASE" in publications.

  5. What is the shipping cost for "PPAT Antibody - N-terminal region (ARP46079_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PPAT Antibody - N-terminal region (ARP46079_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PPAT Antibody - N-terminal region (ARP46079_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "57 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PPAT Antibody - N-terminal region (ARP46079_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PPAT"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PPAT"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PPAT"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PPAT"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PPAT"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PPAT"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PPAT Antibody - N-terminal region (ARP46079_P050)
Your Rating
We found other products you might like!