website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

PPARGC1A antibody - N-terminal region (ARP31507_P050)

Receive a free positive control (AHL002) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.

Anti-PGC-1α ARP31507_P050 has recently been referenced in the following publications:

Lee, Y. H. et al. Integrative toxicoproteomics implicates impaired mitochondrial glutathione import as an off-target effect of troglitazone. J. Proteome Res. 12, 2933–45 (2013). WB, Mouse 23659346

Description of Target:
PPARGC1A is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity.The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
Peroxisome proliferator-activated receptor gamma, coactivator 1 alpha
NCBI Gene Id:
Alias Symbols:
LEM6; PGC-1(alpha); PGC-1v; PGC1; PGC1A; PPARGC1
Tissue Tool:
Find tissues and cell lines supported to express PPARGC1A.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-PPARGC1A antibody: synthetic peptide directed towards the N terminal of human PPARGC1A
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
PPARGC1A antibody - N-terminal region (ARP31507_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Goat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 82%
Species Reactivity:
Human, Dog, Rat, Guinea pig, Goat, Bovine, Mouse, Horse, Rabbit, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-PPARGC1A antibody
- ARP31507_P050
Peptide Sequence:
Synthetic peptide located within the following region: PSFDALTDGDVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQL
Blocking Peptide:
For anti-PPARGC1A antibody is Catalog # AAP31507 (Previous Catalog # AAPP02269)
Key Reference:
Vimaleswaran,K.S., (er) J. Appl. Physiol. (2008) In press
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-PPARGC1A antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question