website statistics

Aviva Systems Biology office will be closed for Memorial Day - 5/29/2017.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PPARGC1A antibody - N-terminal region (ARP31507_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP31507_P050-FITC Conjugated

ARP31507_P050-HRP Conjugated

ARP31507_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Peroxisome proliferator-activated receptor gamma, coactivator 1 alpha
Protein Name:
Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
LEM6, PGC-1(alpha), PGC-1v, PGC1, PGC1A, PPARGC1
Replacement Item:
This antibody may replace item sc-13067 from Santa Cruz Biotechnology.
Description of Target:
PPARGC1A is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity.The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PPARGC1A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PPARGC1A.
The immunogen is a synthetic peptide directed towards the N terminal region of human PPARGC1A
Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 82%
Complete computational species homology data:
Anti-PPARGC1A (ARP31507_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PSFDALTDGDVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-PPARGC1A (ARP31507_P050) antibody is Catalog # AAP31507 (Previous Catalog # AAPP02269)
Datasheets / Downloads:
Printable datasheet for anti-PPARGC1A (ARP31507_P050) antibody
Target Reference:
Vimaleswaran,K.S., (er) J. Appl. Physiol. (2008) In press

Lee, Y. H. et al. Integrative toxicoproteomics implicates impaired mitochondrial glutathione import as an off-target effect of troglitazone. J. Proteome Res. 12, 2933-45 (2013). WB, Human, Dog, Rat, Guinea pig, Goat, Bovine, Mouse, Horse, Rabbit, Zebrafish 23659346

Product Protocols: PPARGC1A antibody tested with Human Jurkat Cells (ARP31507_P050)

Aviva Systems Biology is the original manufacturer of this PPARGC1A antibody (ARP31507_P050)

Click here to view the PPARGC1A antibody Western Blot Protocol

Product Datasheet Link: PPARGC1A antibody (ARP31507_P050)

WB Suggested Anti-PPARGC1A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat

Western Blot image:

Description of Target: PPARGC1A is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity.The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s PPARGC1A antibody (ARP31507_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Review: PPARGC1A antibody - N-terminal region (ARP31507_P050) in Mouse retina using IF

Product Page for PPARGC1A antibody - N-terminal region (ARP31507_P050)

Researcher: Dr. Joshua Sanes
Application: IF
Species+tissue/cell type: Mouse retina
Primary antibody dilution:1:200
Secondary antibody: Donkey anti rabbit-Cy3
Secondary antibody dilution: 1:1000

Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...