website statistics
Account Login 

Aviva Systems Biology office will be closed for Christmas and New Year holidays - 12/24/2014, 12/25/2014 and 1/1/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

PPARGC1A antibody - N-terminal region (ARP31507_P050)

Receive a free positive control (AHL002) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
PPARGC1A is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity.The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
Peroxisome proliferator-activated receptor gamma, coactivator 1 alpha
NCBI Gene Id:
Alias Symbols:
LEM6; PGC-1(alpha); PGC-1v; PGC1; PGC1A; PPARGC1
Tissue Tool:
Find tissues and cell lines supported to express PPARGC1A.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-PPARGC1A antibody: synthetic peptide directed towards the N terminal of human PPARGC1A
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
PPARGC1A antibody - N-terminal region (ARP31507_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Goat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 82%
Species Reactivity:
Human, Dog, Rat, Guinea pig, Goat, Bovine, Mouse, Horse, Rabbit, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-PPARGC1A antibody
- ARP31507_P050
Peptide Sequence:
Synthetic peptide located within the following region: PSFDALTDGDVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQL
Blocking Peptide:
For anti-PPARGC1A antibody is Catalog # AAP31507 (Previous Catalog # AAPP02269)
Target Reference:
Vimaleswaran,K.S., (er) J. Appl. Physiol. (2008) In press
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-PPARGC1A antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Anti-PGC-1α ARP31507_P050 has recently been referenced in the following publications:

Lee, Y. H. et al. Integrative toxicoproteomics implicates impaired mitochondrial glutathione import as an off-target effect of troglitazone. J. Proteome Res. 12, 2933–45 (2013). WB, Mouse 23659346

Computational species homology for PPARGC1A antibody (ARP31507)

Product page for PPARGC1A antibody (ARP31507)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant PPARGC1A antibody; Loxodonta africana PPARGC1A antibody G3TW59 100%
African elephant PPARGC1A antibody; Loxodonta africana PPARGC1A antibody G3TAG2 100%
Bovine PPARGC1A antibody; Bos taurus PPARGC1A antibody B0JYK8 92%
Bovine PRGC1 antibody; Bos taurus PRGC1 antibody Q865B7 92%
Chicken PPARGC1A antibody; Gallus gallus PPARGC1A antibody Q60GU0 100%
Chicken PPARGC1A antibody; Gallus gallus PPARGC1A antibody F1NHI0 100%
Common turkey PPARGC1A antibody; Meleagris gallopavo PPARGC1A antibody G3X8N5 100%
Common turkey PPARGC1A antibody; Meleagris gallopavo PPARGC1A antibody G1NIP7 100%
Dog PPARGC1A antibody; Canis familiaris PPARGC1A antibody E2QYW8 92%
Dog PPARGC1A antibody; Canis familiaris PPARGC1A antibody E2QWA7 92%
Dog PPARGC1A antibody; Canis familiaris PPARGC1A antibody E2QWA6 92%
Domestic water buffalo PPARGC1A antibody; Bubalus bubalis PPARGC1A antibody E5KXH9 92%
Domestic water buffalo PPARGC-1A antibody; Bubalus bubalis PPARGC-1A antibody D0VE08 92%
Duckbill platypus PPARGC1A antibody; Ornithorhynchus anatinus PPARGC1A antibody F6WDA2 85%
Duckbill platypus PPARGC1A antibody; Ornithorhynchus anatinus PPARGC1A antibody F6WD94 85%
Giant panda PPARGC1A antibody; Ailuropoda melanoleuca PPARGC1A antibody G1LVA6 92%
Goat PPARGC1A antibody; Capra hircus PPARGC1A antibody G4VXK5 92%
Goat PPARGC1A antibody; Capra hircus PPARGC1A antibody A9YWH5 92%
Gray short-tailed opossum PPARGC1A antibody; Monodelphis domestica PPARGC1A antibody F6XM07 92%
Guinea pig LOC100721512 antibody; Cavia porcellus LOC100721512 antibody H0UWE3 100%
Horse PPARGC1A antibody; Equus caballus PPARGC1A antibody F6YR50 92%
Human PPARGC1A antibody; Homo sapiens PPARGC1A antibody Q4W5M7 100%
Human PPARGC1A antibody; Homo sapiens PPARGC1A antibody Q3LIG1 100%
Human PPARGC1A antibody; Homo sapiens PPARGC1A antibody B7Z406 100%
Human PRGC1 antibody; Homo sapiens PRGC1 antibody Q9UBK2 100%
Little brown bat PPARGC1A antibody; Myotis lucifugus PPARGC1A antibody G1PUB3 92%
Lowland gorilla PPARGC1A antibody; Gorilla gorilla gorilla PPARGC1A antibody G3R2X2 100%
Mouse Ppargc1a antibody; Mus musculus Ppargc1a antibody Q3UP72 92%
Mouse Ppargc1a antibody; Mus musculus Ppargc1a antibody Q3LIG2 92%
Mouse Ppargc1a antibody; Mus musculus Ppargc1a antibody D3Z4V5 92%
Mouse PRGC1 antibody; Mus musculus PRGC1 antibody O70343 92%
Northern white-cheeked gibbon PPARGC1A antibody; Nomascus leucogenys PPARGC1A antibody G1S4A5 100%
Pig PPARGC1 antibody; Sus scrofa PPARGC1 antibody Q5QHW4 91%
Pig PPARGC1A antibody; Sus scrofa PPARGC1A antibody G2ZFY8 92%
Pig PRGC1 antibody; Sus scrofa PRGC1 antibody Q865B6 92%
Rabbit PPARGC1A antibody; Oryctolagus cuniculus PPARGC1A antibody G1U1N7 92%
Rabbit PPARGC1A antibody; Oryctolagus cuniculus PPARGC1A antibody G1T7V8 92%
Rat Ppargc1a antibody; Rattus norvegicus Ppargc1a antibody D3ZI51 100%
Rat PRGC1 antibody; Rattus norvegicus PRGC1 antibody Q9QYK2 100%
Rhesus macaque PPARGC1A antibody; Macaca mulatta PPARGC1A antibody F7GQV9 100%
Small-eared galago PPARGC1A antibody; Otolemur garnettii PPARGC1A antibody H0XBG7 100%
Sumatran orangutan PPARGC1A antibody; Pongo abelii PPARGC1A antibody Q5RBY0 100%
Tasmanian devil PPARGC1A antibody; Sarcophilus harrisii PPARGC1A antibody G3W8C8 92%
Tasmanian devil PPARGC1A antibody; Sarcophilus harrisii PPARGC1A antibody G3W8C6 92%
Western clawed frog ppargc1a antibody; Xenopus tropicalis ppargc1a antibody F7DQH0 100%
White-tufted-ear marmoset PPARGC1A antibody; Callithrix jacchus PPARGC1A antibody F7ISR8 100%
White-tufted-ear marmoset PPARGC1A antibody; Callithrix jacchus PPARGC1A antibody F7I1G0 100%
White-tufted-ear marmoset PPARGC1A antibody; Callithrix jacchus PPARGC1A antibody F7FMX6 100%
White-tufted-ear marmoset PPARGC1A antibody; Callithrix jacchus PPARGC1A antibody F7FLC8 100%
Zebra finch LOC100222781 antibody; Taeniopygia guttata LOC100222781 antibody H0ZGT5 85%

Product Protocols: PPARGC1A antibody tested with Human Jurkat Cells (ARP31507_P050)

Aviva Systems Biology is the original manufacturer of this PPARGC1A antibody (ARP31507_P050)

Click here to view the PPARGC1A antibody Western Blot Protocol

Product Datasheet Link: PPARGC1A antibody (ARP31507_P050)

WB Suggested Anti-PPARGC1A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat

Western Blot image:

Description of Target: PPARGC1A is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity.The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s PPARGC1A antibody (ARP31507_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Review: PPARGC1A antibody - N-terminal region (ARP31507_P050) in Mouse retina using IF

Product Page for PPARGC1A antibody - N-terminal region (ARP31507_P050)

Researcher: Dr. Joshua Sanes
Application: IF
Species+tissue/cell type: Mouse retina
Primary antibody dilution:1:200
Secondary antibody: Donkey anti rabbit-Cy3
Secondary antibody dilution: 1:1000

Ask a Question