website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

PPARGC1A antibody - N-terminal region (ARP31507_P050)

Receive a free positive control (AHL002) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
PPARGC1A is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity.The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
PPARGC1A
Official Gene Full Name:
Peroxisome proliferator-activated receptor gamma, coactivator 1 alpha
NCBI Gene Id:
10891
Alias Symbols:
LEM6; PGC-1(alpha); PGC-1v; PGC1; PGC1A; PPARGC1
Tissue Tool:
Find tissues and cell lines supported to express PPARGC1A.
Protein Accession #:
NP_037393
Nucleotide Accession#:
NM_013261
Swissprot Id:
Q9UBK2
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
Protein Size (# AA):
798
Molecular Weight:
91kDa
Application:
IF, WB
Protein Interactions:
NRIP1; SUMO1; UBE2I; UBC; SIRT1; PPARG; PRKAA1; KAT2A; EGFR; CDK6; CAPNS1; PARK7; PIAS1; SFPQ; ESRRG; RNF2; TP53; HNF4A; CREBZF; NR3C1; ESRRA; RNF34; NR1I2; ESR2; BCL6; SF1; NR5A2; MYEF2; NCOA6; IQGAP1; MYOD1; EP300; LRPPRC; THRB; MYBBP1A; MED1; NR1I3; NC
Immunogen:
The immunogen for anti-PPARGC1A antibody: synthetic peptide directed towards the N terminal of human PPARGC1A
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
PPARGC1A antibody - N-terminal region (ARP31507_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Goat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 82%
Species Reactivity:
Human, Dog, Rat, Guinea pig, Goat, Bovine, Mouse, Horse, Rabbit, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-PPARGC1A antibody
- ARP31507_P050
Peptide Sequence:
Synthetic peptide located within the following region: PSFDALTDGDVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQL
Blocking Peptide:
For anti-PPARGC1A antibody is Catalog # AAP31507 (Previous Catalog # AAPP02269)
Target Reference:
Vimaleswaran,K.S., (er) J. Appl. Physiol. (2008) In press
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Publications:

Lee, Y. H. et al. Integrative toxicoproteomics implicates impaired mitochondrial glutathione import as an off-target effect of troglitazone. J. Proteome Res. 12, 2933-45 (2013). WB, Human, Dog, Rat, Guinea pig, Goat, Bovine, Mouse, Horse, Rabbit, Zebrafish 23659346

Product Protocols: PPARGC1A antibody tested with Human Jurkat Cells (ARP31507_P050)

Aviva Systems Biology is the original manufacturer of this PPARGC1A antibody (ARP31507_P050)

Click here to view the PPARGC1A antibody Western Blot Protocol

Product Datasheet Link: PPARGC1A antibody (ARP31507_P050)

WB Suggested Anti-PPARGC1A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat

Western Blot image:


Description of Target: PPARGC1A is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity.The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s PPARGC1A antibody (ARP31507_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Review: PPARGC1A antibody - N-terminal region (ARP31507_P050) in Mouse retina using IF

Product Page for PPARGC1A antibody - N-terminal region (ARP31507_P050)

Researcher: Dr. Joshua Sanes
Application: IF
Species+tissue/cell type: Mouse retina
Primary antibody dilution:1:200
Secondary antibody: Donkey anti rabbit-Cy3
Secondary antibody dilution: 1:1000

 
X
Ask a Question