PGLS Antibody - middle region (ARP58513_P050)

Catalog No: ARP58513_P050

WB Suggested Anti-PGLS Antibody Titration: 1 ug/ml
Positive Control: 721_B cell lysatePGLS is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Immunohistochemistry with Human Colon lysate tissue at an antibody concentration of 5.0ug/ml using anti-PGLS antibody (ARP58513_P050)

Human Tonsil

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Tonsil, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
  IHC Information: Tonsil, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PGLS
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: AAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PGLS (ARP58513_P050) antibody is Catalog # AAP58513 (Previous Catalog # AAPP34534)
• Sample Type Confirmation:

  PGLS is strongly supported by BioGPS gene expression data to be expressed in 721_B

• Reference: Miclet,E., (2001) J. Biol. Chem. 276 (37), 34840-34846

Target Info

• Gene Symbol: PGLS
• Gene Full Name: 6-phosphogluconolactonase
• Alias Symbols: 6PGL, HEL-S-304
• NCBI Gene Id: 25796
• Protein Name: 6-phosphogluconolactonase
• Description of Target: PGLS belongs to the glucosamine/galactosamine-6-phosphate isomerase family, 6-phosphogluconolactonase subfamily. It is implicated in the hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate.
• Uniprot ID: O95336
• Protein Accession #: NP_036220
• Nucleotide Accession #: NM_012088
• Protein Size (# AA): 258
• Molecular Weight: 28kDa
• Protein Interactions: NOTCH2NL; KRTAP10-3; KRTAP10-8; KRTAP10-9; KRT40; KRTAP4-2; RCHY1; RBPMS; MDFI; KRT31; KRTAP5-9; SUMO2; UBC; TERF2IP; POT1; TERF1; PLSCR1; EWSR1;