SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP46090_T100
Price: $0.00
SKU
ARP46090_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PEX3 (ARP46090_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 5.0 ug/ml. Gel concentration: 12%.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PEX3
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: KYGQKKIREIQEREAAEYIAQARRQYHFESNQRTCNMTVLSMLPTLREAL
Concentration1.0 mg/ml
Blocking PeptideFor anti-PEX3 (ARP46090_T100) antibody is Catalog # AAP46090 (Previous Catalog # AAPP26952)
Sample Type Confirmation

There is BioGPS gene expression data showing that PEX3 is expressed in HepG2

ReferenceFang,Y., (2004) J. Cell Biol. 164 (6), 863-875
Publications

Perilipin-2 Deletion Impairs Hepatic Lipid Accumulation by Interfering with Sterol Regulatory Element-binding Protein (SREBP) Activation and Altering the Hepatic Lipidome. J. Biol. Chem. 291, 24231-24246 (2016). 27679530

Gene SymbolPEX3
Gene Full NamePeroxisomal biogenesis factor 3
Alias SymbolsTRG18, PBD10A, PBD10B
NCBI Gene Id8504
Protein NamePeroxisomal biogenesis factor 3
Description of TargetPEX3 is involved in peroxisome biosynthesis and integrity. It assembles membrane vesicles before the matrix proteins are translocated. As a docking factor for PEX19, it is necessary for the import of peroxisomal membrane proteins in the peroxisomes.
Uniprot IDP56589
Protein Accession #NP_003621
Nucleotide Accession #NM_003630
Protein Size (# AA)373
Molecular Weight42kDa
Protein InteractionsUBC; PEX19; PEX14; CHCHD4; HNRNPR; ABCD3; HNRNPF; DHX15; ABCD1;
  1. What is the species homology for "PEX3 Antibody - N-terminal region (ARP46090_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "PEX3 Antibody - N-terminal region (ARP46090_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PEX3 Antibody - N-terminal region (ARP46090_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PEX3 Antibody - N-terminal region (ARP46090_T100)"?

    This target may also be called "TRG18, PBD10A, PBD10B" in publications.

  5. What is the shipping cost for "PEX3 Antibody - N-terminal region (ARP46090_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PEX3 Antibody - N-terminal region (ARP46090_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PEX3 Antibody - N-terminal region (ARP46090_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "42kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PEX3 Antibody - N-terminal region (ARP46090_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PEX3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PEX3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PEX3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PEX3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PEX3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PEX3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PEX3 Antibody - N-terminal region (ARP46090_T100)
Your Rating