SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP46396_P050
Price: $0.00
SKU
ARP46396_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-OSMR (ARP46396_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human OSMR
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 92%
Peptide SequenceSynthetic peptide located within the following region: LLEKKTGYSQELAPSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQGYH
Concentration0.5 mg/ml
Blocking PeptideFor anti-OSMR (ARP46396_P050) antibody is Catalog # AAP46396 (Previous Catalog # AAPP27180)
Subunitbeta
ReferenceArita,K., (2008) Am. J. Hum. Genet. 82 (1), 73-80
Gene SymbolOSMR
Gene Full NameOncostatin M receptor
Alias SymbolsOSMRB, PLCA1, IL-31RB, OSMRbeta, IL-31R-beta
NCBI Gene Id9180
Protein NameOncostatin-M-specific receptor subunit beta
Description of TargetOncostatin M is a member of the IL6 family of cytokines. Functional receptors for IL6 family cytokines are multisubunit complexes involving members of the hematopoietin receptor superfamily. Many IL6 cytokines utilize gp130 as a common receptor subunit. OSM binds to the gp130 receptor subunit and, in association with the leukemia inhibitory factor receptor, induces a proliferative response in permissive cells. OSMR is an alternative subunit (for an OSM receptor complex (a heterodimer of gp130 and OSMR) that is activated by OSM but not by LIF. Oncostatin M is a member of the IL6 family of cytokines. Functional receptors for IL6 family cytokines are multisubunit complexes involving members of the hematopoietin receptor superfamily. Many IL6 cytokines utilize gp130 as a common receptor subunit. OSM binds to the gp130 receptor subunit and, in association with the leukemia inhibitory factor receptor, induces a proliferative response in permissive cells. OSMR is an alternative subunit (for an OSM receptor complex (a heterodimer of gp130 and OSMR) that is activated by OSM but not by LIF. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ99650
Protein Accession #NP_003990
Nucleotide Accession #NM_003999
Protein Size (# AA)979
Molecular Weight110kDa
Protein InteractionsUBC; CUL5; GAPDH; IL6ST; OSM; JAK2; JAK1; ERBB2;
  1. What is the species homology for "OSMR Antibody - middle region (ARP46396_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "OSMR Antibody - middle region (ARP46396_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "OSMR Antibody - middle region (ARP46396_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "OSMR Antibody - middle region (ARP46396_P050)"?

    This target may also be called "OSMRB, PLCA1, IL-31RB, OSMRbeta, IL-31R-beta" in publications.

  5. What is the shipping cost for "OSMR Antibody - middle region (ARP46396_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "OSMR Antibody - middle region (ARP46396_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "OSMR Antibody - middle region (ARP46396_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "110kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "OSMR Antibody - middle region (ARP46396_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "OSMR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "OSMR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "OSMR"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "OSMR"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "OSMR"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "OSMR"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:OSMR Antibody - middle region (ARP46396_P050)
Your Rating
We found other products you might like!