NTRK3 antibody - C-terminal region (ARP51318_P050)

Catalog#: ARP51318_P050

• Size: 50ug

Human Liver

• Description of Target: NTRK3 is a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in this gene have been associated with medulloblastomas, secretory breast carcinomas and other cancers.This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in this gene have been associated with medulloblastomas, secretory breast carcinomas and other cancers.
• Gene Symbol: NTRK3
• Official Gene Full Name: Neurotrophic tyrosine kinase, receptor, type 3
• Alias Symbols: TRKC; gp145(trkC)
• Protein Accession#: NP_002521
• Nucleotide Accession#: NM_002530
• Swissprot Id: Q16288-3
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 825
• Molecular Weight: 89kDa
• Application: WB
• Partner Proteins: CTSG, F12, F2, FLNA, FLNB, GP1BA, GP5, GP9, ITGAM, KNG1, OSGEP, SELP, TPST1, VWF, YWHAZ, F12, FLNA, FLNB, GP5, SELP, VWF, YWHAZ
• Immunogen: The immunogen for anti-NTRK3 antibody: synthetic peptide directed towards the C terminal of human NTRK3
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Chicken: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Guinea pig: 92%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG
• Blocking Peptide: For anti-NTRK3 antibody is Catalog # AAP51318 (Previous Catalog # AAPS23407)
• Key Reference: Verma,R., (2008) Biol. Psychiatry 63 (12), 1185-1189
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-NTRK3 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: NTRK3 antibody tested with Human Fetal Liver Tissue (ARP51318_P050)

Aviva Systems Biology is the original manufacturer of this NTRK3 antibody (ARP51318_P050)

Click here to view the NTRK3 antibody Western Blot Protocol

Product Datasheet Link: NTRK3 antibody (ARP51318_P050)

WB Suggested Anti-NTRK3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Fetal Liver

Western Blot image:


Description of Target: NTRK3 is a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in this gene have been associated with medulloblastomas, secretory breast carcinomas and other cancers.This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in this gene have been associated with medulloblastomas, secretory breast carcinomas and other cancers.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s NTRK3 antibody (ARP51318_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com