- Description of Target:
- This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.
- Gene Symbol:
- NME1
- Official Gene Full Name:
- Non-metastatic cells 1, protein (NM23A) expressed in
- Alias Symbols:
- AWD; GAAD; NDPKA; NM23; NM23-H1; NB; NBS; NDKA; NDPK-A
- Tissue Tool:
- Find tissues and cell lines supported to express NME1.
- Protein Accession# :
- NP_000260
- Nucleotide Accession#:
- NM_000269
- Swissprot Id:
- P22392
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 152
- Molecular Weight:
- 17kDa
- Application:
- WB, IHC, DB
- Partner Proteins:
- CD47, IL1RAP, JAK2, NOL3, PTPN11, PTPN6, TRIM2, JAK2, NOL3, PTPN6, TRIM2
- Immunogen:
- The immunogen for anti-NME1 antibody: synthetic peptide directed towards the N terminal of human NME1
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- NME1 antibody - N-terminal region (AVARP00009_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Guinea pig: 92%; Chicken: 84%
- Datasheets / Downloads:
- Printable datasheet for
anti-NME1 antibody
- AVARP00009_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: ANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEH
- Blocking Peptide:
- For anti-NME1 antibody is Catalog # AAP30457 (Previous Catalog # AAPP01041)
- Additional Information:
- IHC Information: Immunohistochemical analysis of paraffin-embedded human lung adenocarcinoma tissue using anti-Nm23-H1 antibody (AVARP00009_P050).
IHC Information: Pancreas
IHC Information: Small intestine - Key Reference:
- Liu,S.J., (2008) Br. J. Cancer 98 (2), 363-369
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-NME1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Review: NME1 antibody - N-terminal region (AVARP00009_P050) in Murine 4T1 primary breast tumor and human MDA-MB-231 cells using western blot
Product Page for NME1 antibody - N-terminal region (AVARP00009_P050)
Application: Western blotting
Species+tissue/cell type: Murine 4T1 primary breast tumor and human MDA-MB-231 cells
How many ug’s of tissue/cell lysate run on the gel:
1. 20 ug murine 4T1 primary breast tumor
2. 20 ug human MDA-MB-231 cell lysate
3. 20 ug murine 4T1 primary breast tumor
Primary antibody dilution: 1:2000
Secondary antibody: Goat anti-rabbit-Alexa Fluor 680
Secondary antibody dilution: 1:25,000
Western Protocol
Prepared samples: used 20-25ug of protein and added 4xSDS and β-mercaptoethanol (for a final conc. of 1xSDS and 5%β-mercaptoethanol).
Boiled samples for 5 mins to reduce proteins and cooled on ice.
Ran AnykD western (BioRAD, 456-9034) at 200 V for ~40 mins.
Transferred to Trans-Blot Turbo nitrocellulose(BioRAD, 170-4159).
Blocked in 5% BSA in 1xPBST (1XPBS + 0.1% Tween) for 1 hour at room temperature.
Primary antibody (diluted in 5% BSA) incubation in cold room overnight.
Wash (3x) with 1x PBST for 10mins in cold room.
Secondary Antibody, AlexaFluor 680 Donkey anti-rabbit IgG (Invitrogen, A10043), (1:25,000) in cold room for 1 hour.
Wash (3x) with 1x PBST for 10mins in cold room.
Wash (1x) with 1xPBS for 10mins in cold room.
Product Review: NME1 antibody - N-terminal region (AVARP00009_P050) in recomninant human NME2 protein using NDPK-B dot blot
Product Page for NME1 antibody - N-terminal region (AVARP00009_P050)
Application: Dot blot
Species+tissue/cell type: Recombinant human NME2 protein
How many ug’s of tissue/cell lysate run on the gel: 200ng recombinant human NME2 protein
Primary antibody dilution: 1:2000
Secondary antibody: Goat anti-rabbit-Alexa Fluor 680
Secondary antibody dilution: 1:25,000
Dot Blot Protocol
Loaded 0.2ug of recombinant NDPK-B protein (ABNOVA, H00004831-P01) directly onto the nitrocellulose paper.
Blocked in 5% BSA in 1xPBST (1XPBS + 0.1% Tween) for 1 hour at room temperature.
Primary antibody (diluted in 5% BSA) incubation in cold room overnight.
Wash (3x) with 1x PBST for 10mins in cold room.
Secondary Antibody, Alexa Fluor 680 Donkey anti-rabbit IgG (Invitrogen, A10043), (1:25,000) in cold room for 1 hour.
Wash (3x) with 1x PBST for 10mins in cold room.
Wash (1x) with 1xPBS for 10mins in cold room.
Product Review: NME1 antibody - N-terminal region (AVARP00009_P050) in Murine 4T1 primary breast tumor and human MDA-MB-231 cells using western blot
Product Page for NME1 antibody - N-terminal region (AVARP00009_P050)
Application: Western blotting
Species+tissue/cell type: Murine 4T1 primary breast tumor and human MDA-MB-231 cells
How many ug’s of tissue/cell lysate run on the gel:
1. 20 ug murine 4T1 primary breast tumor cell lysate
2. 20 ug human MDA-MB-231 cell lysate
3. 20 ug murine 4T1 primary breast tumor cell lysate
Primary antibody dilution: 1:4000
Secondary antibody: Goat anti-rabbit-Alexa Fluor 680
Secondary antibody dilution: 1:25,000
Western Protocol
Prepared samples: used 20-25ug of protein and added 4xSDS and β-mercaptoethanol (for a final conc. of 1xSDS and 5%β-mercaptoethanol).
Boiled samples for 5 mins to reduce proteins and cooled on ice.
Ran AnykD western (BioRAD, 456-9034) at 200 V for ~40 mins.
Transferred to Trans-Blot Turbo nitrocellulose(BioRAD, 170-4159).
Blocked in 5% BSA in 1xPBST (1XPBS + 0.1% Tween) for 1 hour at room temperature.
Primary antibody (diluted in 5% BSA) incubation in cold room overnight.
Wash (3x) with 1x PBST for 10mins in cold room.
Secondary Antibody, AlexaFluor 680 Donkey anti-rabbit IgG (Invitrogen, A10043), (1:25,000) in cold room for 1 hour.
Wash (3x) with 1x PBST for 10mins in cold room.
Wash (1x) with 1xPBS for 10mins in cold room.
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
