NARG1 Antibody - middle region (ARP48990_P050)

Catalog No: ARP48990_P050

WB Suggested Anti-NARG1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: THP-1 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NARG1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: PPVFNTLRSLYKDKEKVAIIEELVVGYETSLKSCRLFNPNDDGKEEPPTT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NAA15 (ARP48990_P050) antibody is Catalog # AAP48990 (Previous Catalog # AAPY02136)
• Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Target Info

• Gene Symbol: NAA15
• Gene Full Name: N(alpha)-acetyltransferase 15, NatA auxiliary subunit
• Alias Symbols: Ga19, NATH, TBDN, MRD50, NARG1, NAT1P, TBDN100
• NCBI Gene Id: 80155
• Protein Name: N-alpha-acetyltransferase 15, NatA auxiliary subunit
• Description of Target: The ARD1A-NARG1 complex displays alpha (N-terminal) acetyltransferase activity that may be important for vascular, hematopoietic and neuronal growth and development. NARG1 is required to control retinal neovascularization in adult ocular endothelial cells. In complex with G22P1 and XRCC5 (Ku80), up-regulates transcription from the osteocalcin promoter.This gene encodes a protein of unknown function. However, similarity to proteins in yeast and other species suggests that this protein may be an N-acetyltransferase. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q9BXJ9
• Protein Accession #: NP_476516
• Nucleotide Accession #: NM_057175
• Protein Size (# AA): 866
• Molecular Weight: 101kDa
• Protein Interactions: UBC; SUMO2; NAA50; DDI2; HYPK; VPS26A; NAA10; TSNAX; STAT1; VCAM1; ITGA4; FN1; ASUN; MATR3; SIRT7; RAD21; Naa15; XRCC5; XRCC6; UBA5; NAA11;