LIN7C Antibody - N-terminal region (ARP42907_P050)

Catalog No: ARP42907_P050

WB Suggested Anti-LIN7C Antibody Titration: 1 ug/ml
Positive Control: HepG2 cell lysate

Immunohistochemistry with Human Colon lysate tissue at an antibody concentration of 5.0ug/ml using anti-LIN7C antibody (ARP42907_P050)

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Human Tonsil (formalin-fixed, paraffin-embedded) stained with LIN7C antibody ARP42907_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
  IHC Information: Human Tonsil (formalin-fixed, paraffin-embedded) stained with LIN7C antibody ARP42907_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LIN7C
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-LIN7C (ARP42907_P050) antibody is Catalog # AAP42907 (Previous Catalog # AAPP11132)
• Reference: Lanktree,M., (er) Am. J. Med. Genet. B Neuropsychiatr. Genet. (2008) In press

Target Info

• Gene Symbol: LIN7C
• Gene Full Name: Lin-7 homolog C (C. elegans)
• Alias Symbols: MALS3, VELI3, LIN-7C, MALS-3, LIN-7-C
• NCBI Gene Id: 55327
• Protein Name: Protein lin-7 homolog C
• Description of Target: LIN7C plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. It forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. LIN7C ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. It is also required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells.
• Uniprot ID: Q9NUP9
• Protein Accession #: NP_060832
• Nucleotide Accession #: NM_018362
• Protein Size (# AA): 197
• Molecular Weight: 22kDa
• Protein Interactions: UBC; AMOTL2; LATS2; YAP1; Wwtr1; CFTR; ELAVL1; AMOT; UIMC1; SPATA2; KCNJ12; BAIAP2; ABCA1; HTR2C; CASK; KCNJ4; DLG1; APBA1;