SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP42908_P050
Price: $0.00
SKU
ARP42908_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-LIN7C (ARP42908_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Additional InformationIHC Information: Human Tonsil (formalin-fixed, paraffin-embedded) stained with LIN7C antibody ARP42908_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
IHC Information: Human Tonsil (formalin-fixed, paraffin-embedded) stained with LIN7C antibody ARP42908_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human LIN7C
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: MGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAV
Concentration0.5 mg/ml
Blocking PeptideFor anti-LIN7C (ARP42908_P050) antibody is Catalog # AAP42908 (Previous Catalog # AAPP11133)
Sample Type Confirmation

LIN7C is supported by BioGPS gene expression data to be expressed in MCF7

ReferenceLanktree,M., (er) Am. J. Med. Genet. B Neuropsychiatr. Genet. (2008) In press
Gene SymbolLIN7C
Gene Full NameLin-7 homolog C (C. elegans)
Alias SymbolsMALS3, VELI3, LIN-7C, MALS-3, LIN-7-C
NCBI Gene Id55327
Protein NameProtein lin-7 homolog C
Description of TargetLIN7C plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. It forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. LIN7C ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. It is also required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells.
Uniprot IDQ9NUP9
Protein Accession #NP_060832
Nucleotide Accession #NM_018362
Protein Size (# AA)197
Molecular Weight22kDa
Protein InteractionsUBC; AMOTL2; LATS2; YAP1; Wwtr1; CFTR; ELAVL1; AMOT; UIMC1; SPATA2; KCNJ12; BAIAP2; ABCA1; HTR2C; CASK; KCNJ4; DLG1; APBA1;
  1. What is the species homology for "LIN7C Antibody - middle region (ARP42908_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "LIN7C Antibody - middle region (ARP42908_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LIN7C Antibody - middle region (ARP42908_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LIN7C Antibody - middle region (ARP42908_P050)"?

    This target may also be called "MALS3, VELI3, LIN-7C, MALS-3, LIN-7-C" in publications.

  5. What is the shipping cost for "LIN7C Antibody - middle region (ARP42908_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LIN7C Antibody - middle region (ARP42908_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LIN7C Antibody - middle region (ARP42908_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "22kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LIN7C Antibody - middle region (ARP42908_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "LIN7C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LIN7C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LIN7C"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LIN7C"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LIN7C"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LIN7C"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LIN7C Antibody - middle region (ARP42908_P050)
Your Rating
We found other products you might like!