KIR2DL4 Antibody - middle region (ARP42025_P050)

Catalog No: ARP42025_P050

WB Suggested Anti-KIR2DL4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Thymus

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIR2DL4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: VSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-KIR2DL4 (ARP42025_P050) antibody is Catalog # AAP42025 (Previous Catalog # AAPP24506)
• Reference: Schellekens,J., (2008) Mol. Immunol. 45 (7), 1900-1906

Target Info

• Gene Symbol: KIR2DL4
• Gene Full Name: Killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4
• Alias Symbols: G9P, CD158D, KIR103, KIR-2DL4, KIR103AS, KIR-103AS
• NCBI Gene Id: 3805
• Protein Name: Killer cell immunoglobulin-like receptor KIR2DL4 EMBL AAG44820.1
• Description of Target: Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the
• Uniprot ID: Q8NHK1
• Protein Accession #: NP_001074241
• Nucleotide Accession #: NM_001080772
• Protein Size (# AA): 273
• Molecular Weight: 30kDa
• Protein Interactions: RBPMS; TRIP6; TRAF6; RNF216; UBC; FCER1G; HLA-G;