IL28RA Antibody - N-terminal region (ARP48069_P050)

Catalog No: ARP48069_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. A ~35 kDa isoform also contains this peptide.

Host: Rabbit
Target Name: IL28RA
Sample Tissue: Human Fetal Lung
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target: IFNLR1
Positive control (+): Human Ovary (OV)
Negative control (-): MCF7 (N10)
Antibody concentration: 0.5ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IL28RA
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 77%; Rabbit: 86%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-IFNLR1 (ARP48069_P050) antibody is Catalog # AAP48069 (Previous Catalog # AAPS21112)
• Subunit: alpha
• Enhanced Validation:

  Relative Expression (Western Blot)

• Reference: Chae,S.C., (2006) Exp. Mol. Med. 38 (3), 302-309
• Publications:

  Mucha, J., Majchrzak, K., Taciak, B., Hellmén, E. & Król, M. MDSCs mediate angiogenesis and predispose canine mammary tumor cells for metastasis via IL-28/IL-28RA (IFN-λ) signaling. PLoS One 9, e103249 (2014). 25075523

Target Info

• Gene Symbol: IFNLR1
• Gene Full Name: Interleukin 28 receptor, alpha (interferon, lambda receptor)
• Alias Symbols: IFNLR, LICR2, IL28RA, CRF2/12, IL-28R1
• NCBI Gene Id: 163702
• Protein Name: Interleukin-28 receptor subunit alpha
• Description of Target: IL28RA belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported.
• Uniprot ID: Q5VTX8
• Protein Accession #: NP_775087
• Nucleotide Accession #: NM_173064
• Protein Size (# AA): 491
• Molecular Weight: 57 kDa
• Protein Interactions: IFNLR1; IFNL1; IFNL2; LSM8;