website statistics
Account Login 

Aviva Systems Biology office will be closed for Thanksgiving - Thursday 11/27/2014 and Friday 11/28/2014.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100ug
$229.00
In Stock

IFI44L antibody - N-terminal region (ARP46166_T100)

Description of Target:
The function remains known.
Gene Symbol:
IFI44L
Official Gene Full Name:
Interferon-induced protein 44-like
NCBI Gene Id:
10964
Alias Symbols:
C1orf29; GS3686
Tissue Tool:
Find tissues and cell lines supported to express IFI44L.
Protein Accession #:
NP_006811
Nucleotide Accession#:
NM_006820
Swissprot Id:
Q99984
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Interferon-induced protein 44-like
Protein Size (# AA):
413
Molecular Weight:
47kDa
Application:
IHC, WB
Partner Proteins:
PCNA, C1orf103, C7orf64, COPS6, EEF1A1, MED31, PCNA, RFC2, RFC4, UNC119, BRD4, C1orf103, C7orf64, CD40, CHTF18, COPS6, EEF1A1, MED31, MEPCE, PCNA, RAD17, RFC1, RFC2, RFC4, RPAP3, RUVBL2, UNC119
Immunogen:
The immunogen for anti-IFI44L antibody: synthetic peptide directed towards the N terminal of human IFI44L
Product Format:
Lyophilized powder
Purification:
Protein A purified
Complete computational species homology data:
IFI44L antibody - N-terminal region (ARP46166_T100)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Human
Datasheets / Downloads:
Printable datasheet for
anti-IFI44L antibody
- ARP46166_T100
Peptide Sequence:
Synthetic peptide located within the following region: MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT
Blocking Peptide:
For anti-IFI44L antibody is Catalog # AAP46166 (Previous Catalog # AAPP27004)
Additional Information:
IHC Information: Jurkat cell lysate. Antibody concentration: 5.0 ug/ml. Gel concentration: 12%.
Target Reference:
Suzuki,Y., Gene 200 (1-2), 149-156 (1997)
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-IFI44L antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for IFI44L antibody (ARP46166)

Product page for IFI44L antibody (ARP46166)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Human IF44L antibody; Homo sapiens IF44L antibody Q53G44 92%
Human IF44L antibody; Homo sapiens IF44L antibody Q53G44-2 92%
Human IFI44L antibody; Homo sapiens IFI44L antibody C9JPJ0 92%
Lowland gorilla IFI44L antibody; Gorilla gorilla gorilla IFI44L antibody G3RCT4 100%
Rhesus macaque IFI44L antibody; Macaca mulatta IFI44L antibody F7G1H1 100%

Product Protocols: IFI44L antibody tested by IHC with human kidney (ARP46166)

Aviva Systems Biology is the original manufacturer of this IFI44L antibody.

Click here to view the IFI44L antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: IFI44L antibody (ARP46166)

IHC Information:

Rabbit Anti-IFI44L Antibody
Catalog Number: ARP46166
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

 
X
Ask a Question