website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

IFI44L antibody - N-terminal region (ARP46166_T100)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
$229.00
In Stock

Conjugation Options

ARP46166_T100-FITC Conjugated

ARP46166_T100-HRP Conjugated

ARP46166_T100-Biotin Conjugated

Gene Symbol:
IFI44L
NCBI Gene Id:
10964
Official Gene Full Name:
Interferon-induced protein 44-like
Protein Name:
Interferon-induced protein 44-like
Swissprot Id:
Q99984
Protein Accession #:
NP_006811
Nucleotide Accession #:
NM_006820
Alias Symbols:
C1orf29, GS3686
Replacement Item:
This antibody may replace item sc-101981 from Santa Cruz Biotechnology.
Description of Target:
The function remains known.
Protein Size (# AA):
413
Molecular Weight:
47kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express IFI44L.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express IFI44L.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human IFI44L
Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-IFI44L (ARP46166_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-IFI44L (ARP46166_T100) antibody is Catalog # AAP46166 (Previous Catalog # AAPP27004)
Datasheets / Downloads:
Printable datasheet for anti-IFI44L (ARP46166_T100) antibody
Additional Information:
IHC Information: Jurkat cell lysate. Antibody concentration: 5.0 ug/ml. Gel concentration: 12%.
Target Reference:
Suzuki,Y., Gene 200 (1-2), 149-156 (1997)
 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...