website statistics
Account Login 

Aviva Systems Biology office will be closed for Memorial Day - 5/30/2016.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!


IFI44L antibody - N-terminal region (ARP46166_T100)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
In Stock
Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Interferon-induced protein 44-like
Protein Name:
Interferon-induced protein 44-like
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
C1orf29, GS3686
Description of Target:
The function remains known.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express IFI44L.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express IFI44L.
The immunogen is a synthetic peptide directed towards the N terminal region of human IFI44L
Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-IFI44L (ARP46166_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-IFI44L (ARP46166_T100) antibody is Catalog # AAP46166 (Previous Catalog # AAPP27004)
Datasheets / Downloads:
Printable datasheet for anti-IFI44L (ARP46166_T100) antibody
Additional Information:
IHC Information: Jurkat cell lysate. Antibody concentration: 5.0 ug/ml. Gel concentration: 12%.
Target Reference:
Suzuki,Y., Gene 200 (1-2), 149-156 (1997)

Product Protocols: IFI44L antibody tested by IHC with human kidney (ARP46166)

Aviva Systems Biology is the original manufacturer of this IFI44L antibody.

Click here to view the IFI44L antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: IFI44L antibody (ARP46166)

IHC Information:

Rabbit Anti-IFI44L Antibody
Catalog Number: ARP46166
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question