website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

IFI44L antibody - N-terminal region (ARP46166_T100)

Description of Target:
The function remains known.
Gene Symbol:
Official Gene Full Name:
Interferon-induced protein 44-like
NCBI Gene Id:
Alias Symbols:
C1orf29; GS3686
Tissue Tool:
Find tissues and cell lines supported to express IFI44L.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Interferon-induced protein 44-like
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
PCNA, C1orf103, C7orf64, COPS6, EEF1A1, MED31, PCNA, RFC2, RFC4, UNC119, BRD4, C1orf103, C7orf64, CD40, CHTF18, COPS6, EEF1A1, MED31, MEPCE, PCNA, RAD17, RFC1, RFC2, RFC4, RPAP3, RUVBL2, UNC119
The immunogen for anti-IFI44L antibody: synthetic peptide directed towards the N terminal of human IFI44L
Product Format:
Lyophilized powder
Protein A purified
Complete computational species homology data:
IFI44L antibody - N-terminal region (ARP46166_T100)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Datasheets / Downloads:
Printable datasheet for
anti-IFI44L antibody
- ARP46166_T100
Peptide Sequence:
Synthetic peptide located within the following region: MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT
Blocking Peptide:
For anti-IFI44L antibody is Catalog # AAP46166 (Previous Catalog # AAPP27004)
Additional Information:
IHC Information: Jurkat cell lysate. Antibody concentration: 5.0 ug/ml. Gel concentration: 12%.
Key Reference:
Suzuki,Y., Gene 200 (1-2), 149-156 (1997)
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-IFI44L antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question