HAVCR2 Antibody - N-terminal region (ARP45550_P050)

Catalog No: ARP45550_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-HAVCR2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: OVCAR-3 cell lysate

Researcher: Dr. Maria de Lourdes Munoz, Department of Genetics and Molecular Biology
Application: Western blotting
Species + Tissue/Cell type: Aedes albopictus c6/36 cells, Aedes aegypti midguts, human WBC
How many ug's of tissue/cell lysate run on the gel: 1. 10 ug Aedes albopictus c6/36 cell lysate 2. 10 ug Aedes aegypti midgut lysate 3. 10 ug human white blood cell lysate
Primary antibody dilution: 1:1000
Secondary antibody: Goat Anti-Rabbit HRP
Secondary antibody dilution: 1:5000

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Dog
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HAVCR2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 79%; Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HAVCR2 (ARP45550_P050) antibody is Catalog # AAP45550 (Previous Catalog # AAPY01262)
• Reference: Nuchnoi,P., Ann. Hum. Genet. 72 (PT 3), 327-336 (2008)

Target Info

• Gene Symbol: HAVCR2
• Gene Full Name: Hepatitis A virus cellular receptor 2
• Alias Symbols: TIM3, CD366, KIM-3, SPTCL, TIMD3, Tim-3, TIMD-3, HAVcr-2
• NCBI Gene Id: 84868
• Protein Name: Hepatitis A virus cellular receptor 2
• Description of Target: HAVCR2 regulates macrophage activation. HAVCR2 inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses and promotes immunological tolerance. HAVCR2 may be also involved in T-cell homing. HAVCR2 is the receptor for LGALS9.CD4 (MIM 186940)-positive T helper lymphocytes can be divided into types 1 (Th1) and 2 (Th2) on the basis of their cytokine secretion patterns. Th1 cells and their associated cytokines are involved in cell-mediated immunity to intracellular pathogens and delayed-type hypersensitivity reactions, whereas Th2 cells are involved in the control of extracellular helminthic infections and the promotion of atopic and allergic diseases. The 2 types of cells also cross-regulate the functions of the other. TIM3 is a Th1-specific cell surface protein that regulates macrophage activation and enhances the severity of experimental autoimmune encephalomyelitis in mice.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q8TDQ0
• Protein Accession #: NP_116171
• Nucleotide Accession #: NM_032782
• Protein Size (# AA): 301
• Molecular Weight: 33kDa
• Protein Interactions: BAG6; LCK; APP; HAVCR2;