SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: AVARP13032_T100
Price: $0.00
SKU
AVARP13032_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-GABRD (AVARP13032_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Cow, Dog, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GABRD
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%
Peptide SequenceSynthetic peptide located within the following region: MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAG
Concentration1.0 mg/ml
Blocking PeptideFor anti-GABRD (AVARP13032_T100) antibody is Catalog # AAP30692
Subunitdelta
ReferenceEmberger,W., et al., (2000) Cytogenet. Cell Genet. 89 (3-4), 281-282
Gene SymbolGABRD
Gene Full NameGamma-aminobutyric acid (GABA) A receptor, delta
Alias SymbolsEJM7, EIG10, GEFSP5
NCBI Gene Id2563
Protein NameGamma-aminobutyric acid receptor subunit delta
Description of TargetGamma-aminobutyric acid (GABA) is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. The GABA-A receptor is generally pentameric and there are five types of subunits: alpha, beta, gamma, delta, and rho. This gene encodes the delta subunit.
Uniprot IDO14764
Protein Accession #NP_000806
Nucleotide Accession #NM_000815
Protein Size (# AA)452
Molecular Weight51kDa
Protein InteractionsNOTCH2NL; UBQLN1; UBQLN4; UBC;
  1. What is the species homology for "GABRD Antibody - N-terminal region (AVARP13032_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Cow, Dog, Rabbit".

  2. How long will it take to receive "GABRD Antibody - N-terminal region (AVARP13032_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GABRD Antibody - N-terminal region (AVARP13032_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GABRD Antibody - N-terminal region (AVARP13032_T100)"?

    This target may also be called "EJM7, EIG10, GEFSP5" in publications.

  5. What is the shipping cost for "GABRD Antibody - N-terminal region (AVARP13032_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GABRD Antibody - N-terminal region (AVARP13032_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GABRD Antibody - N-terminal region (AVARP13032_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "51kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GABRD Antibody - N-terminal region (AVARP13032_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GABRD"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GABRD"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GABRD"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GABRD"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GABRD"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GABRD"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GABRD Antibody - N-terminal region (AVARP13032_T100)
Your Rating
We found other products you might like!