FEZF1 antibody - C-terminal region (ARP50396_P050)

Catalog#: ARP50396_P050

• Size: 50ug

Human HeLa

Human Pancreas

Human Pancreas

Human Placenta

• Description of Target: FEZF1 is a transcription repressor. It is involved in the axonal projection and proper termination of olfactory sensory neurons (OSN). It plays a role in rostro-caudal patterning of the diencephalon and in prethalamic formation. Expression of the FEZF1 is required in OSN to cell-autonomously regulate OSN axon projections. FEZF1 regulates non-cell-autonomously the layer formation of the olfactory bulb development and the interneurons. It may be required for correct rostral migration of the interneuron progenitors.
• Gene Symbol: FEZF1
• Official Gene Full Name: FEZ family zinc finger 1
• Alias Symbols: ZNF312B; FEZ
• Protein Accession#: NP_001019784
• Nucleotide Accession#: NM_001024613
• Swissprot Id: A0PJY2
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 471
• Molecular Weight: 52kDa
• Application: WB, IHC
• Immunogen: The immunogen for anti-FEZF1 antibody: synthetic peptide directed towards the C terminal of human FEZF1
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Rabbit: 92%; Guinea pig: 78%; Horse: 78%
• Peptide Sequence: Synthetic peptide located within the following region: CPTCGKGFCRNFDLKKHVRKLHDSSLGLARTPAGEPGTEPPPPLPQQPPM
• Blocking Peptide: For anti-FEZF1 antibody is Catalog # AAP50396 (Previous Catalog # AAPP13742)
• Additional Information: IHC Information: Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)
  IHC Information: Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)
  IHC Information: Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
• Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-FEZF1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.