website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

EAP30 antibody - N-terminal region (ARP31531_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP31531_P050-FITC Conjugated

ARP31531_P050-HRP Conjugated

ARP31531_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae)
Protein Name:
Vacuolar-sorting protein SNF8
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Dot3, EAP30, VPS22
Replacement Item:
This antibody may replace item sc-100892 from Santa Cruz Biotechnology.
Description of Target:
ELL encodes an RNA polymerase II transcription factor that undergoes frequent translocation in acute myeloid leukemia (AML). In addition to its elongation activity, ELL contains a novel type of RNA polymerase II interaction domain that is capable of repressing polymerase activity in promoter-specific transcription. EAP30 is a subunit of the ELL complex. EAP30 can interact with ELL and derepress ELL's inhibitory activity in vitro.SNF8, VPS25 (MIM 610907), and VPS36 (MIM 610903) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with RNA polymerase II elongation factor (ELL; MIM 600284) (Slagsvold et al., 2005 [PubMed 15755741]; Kamura et al., 2001 [PubMed 11278625]).[supplied by OMIM].
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EAP30.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EAP30.
The immunogen is a synthetic peptide directed towards the N terminal region of human EAP30
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-EAP30 (ARP31531_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SNF8 (ARP31531_P050) antibody is Catalog # AAP31531 (Previous Catalog # AAPS26305)
Datasheets / Downloads:
Printable datasheet for anti-SNF8 (ARP31531_P050) antibody
Sample Type Confirmation:

SNF8 is supported by BioGPS gene expression data to be expressed in HepG2

Additional Information:
IHC Information: Human Heart: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
Target Reference:
Schmidt,A.E., et al., (1999) Biol. Chem. 274 (31), 21981-21985

Product Protocols: EAP30 antibody tested by IHC with human stomach (ARP31531)

Aviva Systems Biology is the original manufacturer of this EAP30 antibody.

Click here to view the EAP30 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: EAP30 antibody (ARP31531)

IHC Information:

Rabbit Anti-EAP30 Antibody
Catalog Number: ARP31531
Paraffin Embedded Tissue: Human Stomach
Cellular Data: Epithelial cells of Fundic Gland and Surface Mucous Cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...