website statistics
Account Login 

Aviva Systems Biology office will be closed for Christmas and New Year holidays - 12/24/2014, 12/25/2014 and 1/1/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

EAP30 antibody - N-terminal region (ARP31531_P050)

Receive a free positive control (AHL001) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
ELL encodes an RNA polymerase II transcription factor that undergoes frequent translocation in acute myeloid leukemia (AML). In addition to its elongation activity, ELL contains a novel type of RNA polymerase II interaction domain that is capable of repressing polymerase activity in promoter-specific transcription. EAP30 is a subunit of the ELL complex. EAP30 can interact with ELL and derepress ELL's inhibitory activity in vitro.SNF8, VPS25 (MIM 610907), and VPS36 (MIM 610903) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with RNA polymerase II elongation factor (ELL; MIM 600284) (Slagsvold et al., 2005 [PubMed 15755741]; Kamura et al., 2001 [PubMed 11278625]).[supplied by OMIM].
Gene Symbol:
SNF8
Official Gene Full Name:
SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae)
NCBI Gene Id:
11267
Alias Symbols:
Dot3; EAP30; VPS22
Sample Type Confirmation:

SNF8 is supported by BioGPS gene expression data to be expressed in HepG2

Tissue Tool:
Find tissues and cell lines supported to express EAP30.
Protein Accession #:
NP_009172
Nucleotide Accession#:
NM_007241
Swissprot Id:
Q96H20
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Vacuolar-sorting protein SNF8
Protein Size (# AA):
258
Molecular Weight:
29kDa
Application:
IHC, WB
Partner Proteins:
CTBP2, FHL3, CTBP2
Immunogen:
The immunogen for anti-EAP30 antibody: synthetic peptide directed towards the N terminal of human EAP30
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
EAP30 antibody - N-terminal region (ARP31531_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Species Reactivity:
Mouse, Human, Dog, Horse, Rabbit, Rat, Guinea pig, Bovine, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-EAP30 antibody
- ARP31531_P050
Peptide Sequence:
Synthetic peptide located within the following region: MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEF
Blocking Peptide:
For anti-EAP30 antibody is Catalog # AAP31531 (Previous Catalog # AAPS26305)
Additional Information:
IHC Information: Human Heart: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
Target Reference:
Schmidt,A.E., et al., (1999) Biol. Chem. 274 (31), 21981-21985
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-EAP30 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for EAP30 antibody (ARP31531)

Product page for EAP30 antibody (ARP31531)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog LOC100037026 antibody; Xenopus laevis LOC100037026 antibody A1L3J8 100%
African clawed frog LOC100037233 antibody; Xenopus laevis LOC100037233 antibody A2VDE3 100%
African clawed frog snf8 antibody; Xenopus laevis snf8 antibody A9JS29 100%
African elephant LOC100675675 antibody; Loxodonta africana LOC100675675 antibody G3SYG6 100%
African elephant SNF8 antibody; Loxodonta africana SNF8 antibody G3U603 100%
Atlantic salmon Eap30b antibody; Salmo salar Eap30b antibody B3TDE2 92%
Atlantic salmon snf8 antibody; Salmo salar snf8 antibody B3TDC1 100%
blue catfish SNF8 antibody; Ictalurus furcatus SNF8 antibody E3TC43 100%
Bovine SNF8 antibody; Bos taurus SNF8 antibody Q08DR7 100%
Channel catfish snf8 antibody; Ictalurus punctatus snf8 antibody E3TG14 100%
Chicken SNF8 antibody; Gallus gallus SNF8 antibody E1BZH7 100%
Chinese hamster LOC100753514 antibody; Cricetulus griseus LOC100753514 antibody G3HJN4 100%
Common turkey LOC100548114 antibody; Meleagris gallopavo LOC100548114 antibody G1N5F3 100%
Dog SNF8 antibody; Canis familiaris SNF8 antibody E2RTF6 100%
Giant panda LOC100476047 antibody; Ailuropoda melanoleuca LOC100476047 antibody G1LEM3 100%
Gray short-tailed opossum LOC100018637 antibody; Monodelphis domestica LOC100018637 antibody F6YG55 100%
Green anole LOC100563349 antibody; Anolis carolinensis LOC100563349 antibody G1KF82 100%
Guinea pig SNF8 antibody; Cavia porcellus SNF8 antibody H0W400 100%
Horse LOC100055830 antibody; Equus caballus LOC100055830 antibody F6Z295 100%
Human SNF8 antibody; Homo sapiens SNF8 antibody Q96H20 100%
Human SNF8 antibody; Homo sapiens SNF8 antibody Q96H20-2 100%
Human SNF8 antibody; Homo sapiens SNF8 antibody H0Y8S5 100%
Human SNF8 antibody; Homo sapiens SNF8 antibody D6RJ86 100%
Human SNF8 antibody; Homo sapiens SNF8 antibody D6RFY6 100%
Human SNF8 antibody; Homo sapiens SNF8 antibody D6RBI1 100%
Japanese pufferfish Eap30 antibody; Takifugu rubripes Eap30 antibody Q1KKX4 92%
Little brown bat SNF8 antibody; Myotis lucifugus SNF8 antibody G1PJ13 100%
Mouse SNF8 antibody; Mus musculus SNF8 antibody Q9CZ28 100%
Mouse Snf8 antibody; Mus musculus Snf8 antibody A2A6M1 100%
Northern white-cheeked gibbon SNF8 antibody; Nomascus leucogenys SNF8 antibody G1QQX0 100%
Rabbit LOC100345109 antibody; Oryctolagus cuniculus LOC100345109 antibody G1SWN1 100%
Rat SNF8 antibody; Rattus norvegicus SNF8 antibody Q5RK19 100%
Rat Snf8 antibody; Rattus norvegicus Snf8 antibody D3ZPJ3 100%
Rhesus macaque LOC700029 antibody; Macaca mulatta LOC700029 antibody F7GY26 100%
Tasmanian devil SNF8 antibody; Sarcophilus harrisii SNF8 antibody G3WLY6 100%
Three-spined stickleback SNF8 antibody; Gasterosteus aculeatus SNF8 antibody G3NIR3 92%
Western clawed frog SNF8 antibody; Xenopus tropicalis SNF8 antibody Q5RJU0 100%
White-tufted-ear marmoset LOC100395321 antibody; Callithrix jacchus LOC100395321 antibody F7CD17 100%
Zebrafish SNF8 antibody; Danio rerio SNF8 antibody Q5U3V9 92%

Product Protocols: EAP30 antibody tested by IHC with human stomach (ARP31531)

Aviva Systems Biology is the original manufacturer of this EAP30 antibody.

Click here to view the EAP30 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: EAP30 antibody (ARP31531)

IHC Information:

Rabbit Anti-EAP30 Antibody
Catalog Number: ARP31531
Paraffin Embedded Tissue: Human Stomach
Cellular Data: Epithelial cells of Fundic Gland and Surface Mucous Cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

 
X
Ask a Question