website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

EAP30 antibody - N-terminal region (ARP31531_P050)

Receive a free positive control (AHL001) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
ELL encodes an RNA polymerase II transcription factor that undergoes frequent translocation in acute myeloid leukemia (AML). In addition to its elongation activity, ELL contains a novel type of RNA polymerase II interaction domain that is capable of repressing polymerase activity in promoter-specific transcription. EAP30 is a subunit of the ELL complex. EAP30 can interact with ELL and derepress ELL's inhibitory activity in vitro.SNF8, VPS25 (MIM 610907), and VPS36 (MIM 610903) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with RNA polymerase II elongation factor (ELL; MIM 600284) (Slagsvold et al., 2005 [PubMed 15755741]; Kamura et al., 2001 [PubMed 11278625]).[supplied by OMIM].
Gene Symbol:
SNF8
Official Gene Full Name:
SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae)
NCBI Gene Id:
11267
Alias Symbols:
Dot3; EAP30; VPS22
Sample Type Confirmation:

SNF8 is supported by BioGPS gene expression data to be expressed in HepG2

Tissue Tool:
Find tissues and cell lines supported to express EAP30.
Protein Accession #:
NP_009172
Nucleotide Accession#:
NM_007241
Swissprot Id:
Q96H20
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Vacuolar-sorting protein SNF8
Protein Size (# AA):
258
Molecular Weight:
29kDa
Application:
IHC, WB
Partner Proteins:
CTBP2, FHL3, CTBP2
Immunogen:
The immunogen for anti-EAP30 antibody: synthetic peptide directed towards the N terminal of human EAP30
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
EAP30 antibody - N-terminal region (ARP31531_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Species Reactivity:
Mouse, Human, Dog, Horse, Rabbit, Rat, Guinea pig, Bovine, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-EAP30 antibody
- ARP31531_P050
Peptide Sequence:
Synthetic peptide located within the following region: MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEF
Blocking Peptide:
For anti-EAP30 antibody is Catalog # AAP31531 (Previous Catalog # AAPS26305)
Additional Information:
IHC Information: Human Heart: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
Key Reference:
Schmidt,A.E., et al., (1999) Biol. Chem. 274 (31), 21981-21985
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-EAP30 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question