website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

EAP30 antibody - N-terminal region (ARP31531_P050)

Receive a free positive control (AHL001) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
ELL encodes an RNA polymerase II transcription factor that undergoes frequent translocation in acute myeloid leukemia (AML). In addition to its elongation activity, ELL contains a novel type of RNA polymerase II interaction domain that is capable of repressing polymerase activity in promoter-specific transcription. EAP30 is a subunit of the ELL complex. EAP30 can interact with ELL and derepress ELL's inhibitory activity in vitro.SNF8, VPS25 (MIM 610907), and VPS36 (MIM 610903) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with RNA polymerase II elongation factor (ELL; MIM 600284) (Slagsvold et al., 2005 [PubMed 15755741]; Kamura et al., 2001 [PubMed 11278625]).[supplied by OMIM].
Gene Symbol:
SNF8
Official Gene Full Name:
SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae)
NCBI Gene Id:
11267
Alias Symbols:
Dot3; EAP30; VPS22
Sample Type Confirmation:

SNF8 is supported by BioGPS gene expression data to be expressed in HepG2

Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EAP30.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EAP30.
Swissprot Id:
Q96H20
Protein Accession #:
NP_009172
Nucleotide Accession #:
NM_007241
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Vacuolar-sorting protein SNF8
Protein Size (# AA):
258
Molecular Weight:
29kDa
Application:
IHC, WB
Protein Interactions:
GOLGA2; VPS25; TRIM54; VAC14; UBC; BCAT1; SUV39H2; ACBD3; DUS3L; WDR12; PRMT6; RPUSD2; KDM1A; EFTUD2; TTC1; HARS; GTF2F1; GTF2E1; ELL; RBP1; MCM2; ADORA1; METTL14; NUDCD3; RILP; VPS36; CHMP6; VPS28; SNF8; TSG101; VPS20; NIF3L1; DVL2;
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human EAP30
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Anti-EAP30 (ARP31531_P050)
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Species Reactivity:
Cow; Dog; Guinea Pig; Horse; Human; Mouse; Rabbit; Rat; Zebrafish
Datasheets / Downloads:
Printable datasheet for anti-SNF8 (ARP31531_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEF
Blocking Peptide:
For anti-SNF8 (ARP31531_P050) antibody is Catalog # AAP31531 (Previous Catalog # AAPS26305)
Additional Information:
IHC Information: Human Heart: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
Target Reference:
Schmidt,A.E., et al., (1999) Biol. Chem. 274 (31), 21981-21985
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: EAP30 antibody tested by IHC with human stomach (ARP31531)

Aviva Systems Biology is the original manufacturer of this EAP30 antibody.

Click here to view the EAP30 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: EAP30 antibody (ARP31531)

IHC Information:

Rabbit Anti-EAP30 Antibody
Catalog Number: ARP31531
Paraffin Embedded Tissue: Human Stomach
Cellular Data: Epithelial cells of Fundic Gland and Surface Mucous Cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

 
X
Ask a Question