- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-DUT (ARP46027_T100) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IHC, WB |
Additional Information | IHC Information: Jurkat cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 15%. |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human DUT |
Purification | Protein A purified |
Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 93%; Zebrafish: 86% |
Peptide Sequence | Synthetic peptide located within the following region: NFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN |
Concentration | 1.0 mg/ml |
Blocking Peptide | For anti-DUT (ARP46027_T100) antibody is Catalog # AAP46027 (Previous Catalog # AAPP26870) |
Sample Type Confirmation | DUT is strongly supported by BioGPS gene expression data to be expressed in Jurkat |
Reference | Studebaker,A.W., (2005) Biochem. Biophys. Res. Commun. 327 (1), 306-310 |
Gene Symbol | DUT |
---|---|
Gene Full Name | Deoxyuridine triphosphatase |
Alias Symbols | dUTPase |
NCBI Gene Id | 1854 |
Protein Name | Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial |
Description of Target | DUT is an essential enzyme of nucleotide metabolism. This protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death.This gene encodes an essential enzyme of nucleotide metabolism. The encoded protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death. Alternative splicing of this gene leads to different isoforms that localize to either the mitochondrion or nucleus. A related pseudogene is located on chromosome 19. |
Uniprot ID | P33316 |
Protein Accession # | NP_001020419 |
Nucleotide Accession # | NM_001025248 |
Protein Size (# AA) | 252 |
Molecular Weight | 19kDa |
Protein Interactions | GDI2; NUDT18; PLEKHF2; C19orf25; MRPL14; LEMD3; UBL4A; RPL38; UBC; CUL3; ESRRG; ESRRA; ESR1; SPATA2; DUT; PPARD; PPARA; CDK1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "DUT Antibody - C-terminal region (ARP46027_T100)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish".
-
How long will it take to receive "DUT Antibody - C-terminal region (ARP46027_T100)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "DUT Antibody - C-terminal region (ARP46027_T100)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "DUT Antibody - C-terminal region (ARP46027_T100)"?
This target may also be called "dUTPase" in publications.
-
What is the shipping cost for "DUT Antibody - C-terminal region (ARP46027_T100)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "DUT Antibody - C-terminal region (ARP46027_T100)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "DUT Antibody - C-terminal region (ARP46027_T100)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "19kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "DUT Antibody - C-terminal region (ARP46027_T100)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "DUT"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "DUT"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "DUT"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "DUT"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "DUT"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "DUT"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.