DSG2 Antibody - N-terminal region (ARP45198_P050)

Catalog No: ARP45198_P050

WB Suggested Anti-DSG2 Antibody Titration: 1 ug/ml
Positive Control: Hela cell lysate

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

Immunohistochemistry with Human Colon lysate tissue at an antibody concentration of 5.0ug/ml using anti-DSG2 antibody (ARP45198_P050)

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Pancreas, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
  IHC Information: Pancreas, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DSG2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: KIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DSG2 (ARP45198_P050) antibody is Catalog # AAP45198 (Previous Catalog # AAPP26187)
• Enhanced Validation:

  SPR Affinity Characterization

• Reference: Cirillo,N., (2008) J. Cell. Biochem. 103 (2), 598-606
• Publications:

  Hummitzsch, K. et al. A new model of development of the mammalian ovary and follicles. PLoS One 8, e55578 (2013). 23409002

Target Info

• Gene Symbol: DSG2
• Gene Full Name: Desmoglein 2
• Alias Symbols: HDGC, CDHF5
• NCBI Gene Id: 1829
• Protein Name: Desmoglein-2
• Description of Target: Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. DSG2 is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. This second family member is expressed in colon, colon carcinoma, and other simple and stratified epithelial-derived cell lines.Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. This gene product is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. This second family member is expressed in colon, colon carcinoma, and other simple and stratified epithelial-derived cell lines. Mutations in this gene have been associated with arrhythmogenic right ventricular dysplasia, familial, 10. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q14126
• Protein Accession #: NP_001934
• Nucleotide Accession #: NM_001943
• Protein Size (# AA): 1118
• Molecular Weight: 114 kDa
• Protein Interactions: UBC; SART3; EED; ADRB2; PAN2; CHCHD2; PLIN3; Trim69; Cbx1; RYK; PKP3; PKP2; JUP; DSC2; DSC1;