SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP51905_P050
Price: $0.00
SKU
ARP51905_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CYP11A1 (ARP51905_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Placenta, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Placenta, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CYP11A1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: LRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQW
Concentration0.5 mg/ml
Blocking PeptideFor anti-CYP11A1 (ARP51905_P050) antibody is Catalog # AAP51905 (Previous Catalog # AAPP30171)
Sample Type Confirmation

CYP11A1 is supported by BioGPS gene expression data to be expressed in HeLa

Enhanced Validation
Relative Expression (Western Blot) Avivasheild
SPR Affinity Characterization Avivasheild
ReferenceShigematsu,K., (2008) Eur. J. Endocrinol. 158 (6), 867-878
Gene SymbolCYP11A1
Gene Full NameCytochrome P450, family 11, subfamily A, polypeptide 1
Alias SymbolsCYP11A, CYPXIA1, P450SCC
NCBI Gene Id1583
Protein NameCholesterol side-chain cleavage enzyme, mitochondrial
Description of TargetCYP11A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. CYP11A1 localizes to the mitochondrial inner membrane and catalyzes the conversion of cholesterol to pregnenolone, the first and rate-limiting step in the synthesis of the steroid hormones. This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and catalyzes the conversion of cholesterol to pregnenolone, the first and rate-limiting step in the synthesis of the steroid hormones. Two transcript variants encoding different isoforms have been found for this gene. The cellular location of the smaller isoform is unclear since it lacks the mitochondrial-targeting transit peptide.
Uniprot IDP05108
Protein Accession #NP_000772
Nucleotide Accession #NM_000781
Protein Size (# AA)521
Molecular Weight60 kDa
Protein InteractionsSMAD9; SMAD3; SMAD2; CYP11B2; FDX1;
  1. What is the species homology for "CYP11A1 Antibody - middle region (ARP51905_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "CYP11A1 Antibody - middle region (ARP51905_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CYP11A1 Antibody - middle region (ARP51905_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CYP11A1 Antibody - middle region (ARP51905_P050)"?

    This target may also be called "CYP11A, CYPXIA1, P450SCC" in publications.

  5. What is the shipping cost for "CYP11A1 Antibody - middle region (ARP51905_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CYP11A1 Antibody - middle region (ARP51905_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CYP11A1 Antibody - middle region (ARP51905_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "60 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CYP11A1 Antibody - middle region (ARP51905_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CYP11A1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CYP11A1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CYP11A1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CYP11A1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CYP11A1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CYP11A1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CYP11A1 Antibody - middle region (ARP51905_P050)
Your Rating
We found other products you might like!