COBLL1 Antibody - N-terminal region (ARP42423_P050)

Catalog No: ARP42423_P050

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Peptide is present in isoforms of 137 kDa, 128 and 124 kDa. Protein may be phosporylated.

Human kidney

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: HepG2 cell lysate. Antibody concentration: 0.5 ug/ml. Gel concentration: 8%.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human COBLL1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SAPATPLVNKHRPTFTRSNTISKPYISNTLPSDAPKKRRAPLPPMPASQS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-COBLL1 (ARP42423_P050) antibody is Catalog # AAP42423 (Previous Catalog # AAPP11560)
• Sample Type Confirmation:

  COBLL1 is strongly supported by BioGPS gene expression data to be expressed in HepG2

• Enhanced Validation:

  Relative Expression (Western Blot)

• Reference: Carroll,E.A., (2003) Dev. Biol. 262 (1), 16-31

Target Info

• Gene Symbol: COBLL1
• Gene Full Name: COBL-like 1
• Alias Symbols: COBLR1
• NCBI Gene Id: 22837
• Protein Name: Cordon-bleu protein-like 1
• Description of Target: The function remains known.
• Uniprot ID: A6NMZ3
• Protein Accession #: NP_055715
• Nucleotide Accession #: NM_014900
• Protein Size (# AA): 1128
• Molecular Weight: 124 kDa
• Protein Interactions: NRD1; PACSIN1;