C3orf10 Antibody - middle region (ARP51212_T100)

Catalog No: ARP51212_T100

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Antibody Titration: 2.5ug/ml
Positive Control: HepG2

Human Liver

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 15%.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C3orf10
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK
• Concentration: 1.0 mg/ml
• Blocking Peptide: Catalog # AAP51212 (Previous Catalog # AAPP28080)

Target Info

• Gene Symbol: BRK1
• Gene Full Name: BRICK1, SCAR/WAVE actin-nucleating complex subunit
• Alias Symbols: MDS027, hHBrk1, C3orf10, HSPC300
• NCBI Gene Id: 55845
• Protein Name: Protein BRICK1
• Description of Target: C3orf10 is involved in regulation of actin and microtubule organization. It is a part of a WAVE complex that activates the Arp2/3 complex.
• Uniprot ID: Q8WUW1
• Protein Accession #: NP_060932
• Nucleotide Accession #: NM_018462
• Protein Size (# AA): 75
• Molecular Weight: 9kDa
• Protein Interactions: DTNBP1; ACTBL2; NCKAP1; CDKN2A; ACTG1; ACTA1; UBC; PFDN1; CYFIP2; WASF1; NCK1;