BMP2K Antibody - C-terminal region (ARP42483_T100)

Catalog No: ARP42483_T100

WB Suggested Anti-BMP2K Antibody Titration: 5.0ug/ml
Positive Control: HepG2 cell lysate

Human Muscle

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 5.0 ug/ml. Gel concentration: 12%.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human BMP2K
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: AQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSV
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-BMP2K (ARP42483_T100) antibody is Catalog # AAP42483 (Previous Catalog # AAPS12809)
• Reference: Arikawa,T., (2004) J. Cell. Physiol. 200 (3), 400-406

Target Info

• Gene Symbol: BMP2K
• Gene Full Name: BMP2 inducible kinase
• Alias Symbols: BIKE, HRIHFB2017
• NCBI Gene Id: 55589
• Protein Name: Putative uncharacterized protein BMP2K EMBL AAY40926.1
• Description of Target: BMP2K is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. BMP2K is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation.This gene is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. Expression of the mouse gene is increased during BMP-2 induced differentiation and the gene product is a putative serine/threonine protein kinase containing a nuclear localization signal. Therefore, the protein encoded by this human homolog is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. Two transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: Q4W5H2
• Protein Accession #: NP_060063
• Nucleotide Accession #: NM_017593
• Protein Size (# AA): 662
• Molecular Weight: 74kDa
• Protein Interactions: FN1; EPS15; AP2M1; ABL1; TERF2; TERF1; KDM5B; MBP;