website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 48,216 Antibodies & 21,887 Antigens!

Print Page
50ug
$289.00
In Stock

TLR5 antibody - N-terminal region (ARP31753_P050)

Description of Target:
TLR5 participates in the innate immune response to microbial agents. It mediates detection of bacterial flagellins. TLR5 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene product is expressed in myelomonocytic cells, and recognizes bacterial flagellin, a principal component of bacterial flagella and a virulence factor. The activation of this receptor mobilizes the nuclear factor NF-kappaB and stimulates tumour necrosis factor-alpha production. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
TLR5
Official Gene Full Name:
Toll-like receptor 5
Alias Symbols:
FLJ10052; MGC126430; MGC126431; SLEB1; TIL3
Tissue Tool:
Find tissues and cell lines supported to express TLR5.
Protein Accession# :
NP_003259
Nucleotide Accession#:
NM_003268
Swissprot Id:
O60602
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
858
Molecular Weight:
98kDa
Application:
WB
Partner Proteins:
BTK, TLR2, TRAP1
Immunogen:
The immunogen for anti-TLR5 antibody: synthetic peptide directed towards the N terminal of human TLR5
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
TLR5 antibody - N-terminal region (ARP31753_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Bovine: 78%; Goat: 78%
Datasheets / Downloads:
Printable datasheet for
anti-TLR5 antibody
- ARP31753_P050
Peptide Sequence:
Synthetic peptide located within the following region: QLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFH
Blocking Peptide:
For anti-TLR5 antibody is Catalog # AAP31753 (Previous Catalog # AAPP23838)
Key Reference:
Hume,G.E., (2008) Inflamm. Bowel Dis. 14 (5), 585-590
Reconstitution and Storage:
Add 50 μl of distilled water. Final anti-TLR5 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: TLR5 antibody tested with Human Hepg2 Cells (ARP31753_P050)

Aviva Systems Biology is the original manufacturer of this TLR5 antibody (ARP31753_P050)

Click here to view the TLR5 antibody Western Blot Protocol

Product Datasheet Link: TLR5 antibody (ARP31753_P050)

WB Suggested Anti-TLR5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2

Western Blot image:


Description of Target: TLR5 participates in the innate immune response to microbial agents. It mediates detection of bacterial flagellins. TLR5 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene product is expressed in myelomonocytic cells, and recognizes bacterial flagellin, a principal component of bacterial flagella and a virulence factor. The activation of this receptor mobilizes the nuclear factor NF-kappaB and stimulates tumour necrosis factor-alpha production. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s TLR5 antibody (ARP31753_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com