- Description of Target:
- RIPK3 is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor.The product of this gene is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The encoded protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor.
- Gene Symbol:
- RIPK3
- Official Gene Full Name:
- Receptor-interacting serine-threonine kinase 3
- Alias Symbols:
- RIP3; RIP3 beta; RIP3 gamma
- Tissue Tool:
- Find tissues and cell lines supported to express RIPK3.
- Protein Accession# :
- NP_006862
- Nucleotide Accession#:
- NM_006871
- Swissprot Id:
- Q9Y572
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 518
- Molecular Weight:
- 57kDa
- Application:
- WB, IHC
- Immunogen:
- The immunogen for anti-RIPK3 antibody: synthetic peptide directed towards the N terminal of human RIPK3
- Product Format:
- Lyophilized powder
- Purification:
- Protein A purified
- Complete computational species homology data:
- RIPK3 antibody - N-terminal region (ARP31513_T100)
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%; Dog: 92%; Horse: 85%; Mouse: 85%; Pig: 85%; Bovine: 78%
- Datasheets / Downloads:
- Printable datasheet for
anti-RIPK3 antibody
- ARP31513_T100 - Peptide Sequence:
- Synthetic peptide located within the following region: GGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTASDVYSFGILMWAVLAG
- Blocking Peptide:
- For anti-RIPK3 antibody is Catalog # AAP31513 (Previous Catalog # AAPP24084)
- Key Reference:
- Kimura,K., (2006) Genome Res. 16 (1), 55-65
- Reconstitution and Storage:
- Add 100 μl of distilled water. Final anti-RIPK3 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: RIPK3 antibody tested with Human Jurkat Cells (ARP31513_T100)
Aviva Systems Biology is the original manufacturer of this RIPK3 antibody (ARP31513_T100)
Click here to view the RIPK3 antibody Western Blot Protocol
Product Datasheet Link: RIPK3 antibody (ARP31513_T100)
WB Suggested Anti-RIPK3 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat
Western Blot image: 
Description of Target: RIPK3 is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor.The product of this gene is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The encoded protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s RIPK3 antibody (ARP31513_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
Product Protocols: RIPK3 antibody tested by IHC with human liver (ARP31513)
Aviva Systems Biology is the original manufacturer of this RIPK3 antibody.
Click here to view the RIPK3 antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: RIPK3 antibody (ARP31513)
IHC Information:
Rabbit Anti-RIPK3 Antibody
Catalog Number: ARP31513
Paraffin Embedded Tissue: Human Liver
Cellular Data: Hepatocytes
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:
Product Protocols: RIPK3 antibody tested by IHC with human heart (ARP31513)
Aviva Systems Biology is the original manufacturer of this RIPK3 antibody.
Click here to view the RIPK3 antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: RIPK3 antibody (ARP31513)
IHC Information:
Rabbit Anti-RIPK3 Antibody
Catalog Number: ARP31513
Paraffin Embedded Tissue: Human Heart
Cellular Data: Myocardial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
