- Description of Target:
- Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
- Gene Symbol:
- OR13C5
- Official Gene Full Name:
- Olfactory receptor, family 13, subfamily C, member 5
- Alias Symbols:
- OR9-11
- Tissue Tool:
- Find tissues and cell lines supported to express OR13C5.
- Protein Accession# :
- NP_001004482
- Nucleotide Accession#:
- NM_001004482
- Swissprot Id:
- Q8NGS8
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 318
- Molecular Weight:
- 36kDa
- Application:
- WB
- Partner Proteins:
- HCVgp1, ATF6, MBTPS1, MBTPS2, NFYC, PHOX2A, ATF6, NFYA, NFYC
- Immunogen:
- The immunogen for anti-OR13C5 antibody: synthetic peptide directed towards the middle region of human OR13C5
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- OR13C5 antibody - middle region (ARP31561_P050)
- Predicted Homology Based on Immunogen Sequence:
- Dog:100%; Human:100%; Rat:84%;
- Datasheets / Downloads:
- Printable datasheet for
anti-OR13C5 antibody
- ARP31561_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: CGTIFLMYMKPKSQETLNSDDLDATDKLIFIFYRVMTPMMNPLIYSLRNK
- Blocking Peptide:
- For anti-OR13C5 antibody is Catalog # AAP31561 (Previous Catalog # AAPP02339)
- Key Reference:
- Humphray,S.J., (2004) Nature 429 (6990), 369-374
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-OR13C5 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: OR13C5 antibody tested with Human Fetal Liver Tissue (ARP31561_P050)
Aviva Systems Biology is the original manufacturer of this OR13C5 antibody (ARP31561_P050)
Click here to view the OR13C5 antibody Western Blot Protocol
Product Datasheet Link: OR13C5 antibody (ARP31561_P050)
WB Suggested Anti-OR13C5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Fetal Liver
Western Blot image: 
Description of Target: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s OR13C5 antibody (ARP31561_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
