IFI44L antibody - N-terminal region (ARP46166_T100)

Catalog#: ARP46166_T100

• Size: 100ug

Human Jurkat

Human kidney

• Description of Target: The function remains known.
• Gene Symbol: IFI44L
• Official Gene Full Name: Interferon-induced protein 44-like
• Alias Symbols: C1orf29; GS3686
• Protein Accession#: NP_006811
• Nucleotide Accession#: NM_006820
• Swissprot Id: Q99984
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 413
• Molecular Weight: 47kDa
• Application: WB, IHC
• Partner Proteins: PCNA, C1orf103, C7orf64, COPS6, EEF1A1, MED31, PCNA, RFC2, RFC4, UNC119, BRD4, C1orf103, C7orf64, CD40, CHTF18, COPS6, EEF1A1, MED31, MEPCE, PCNA, RAD17, RFC1, RFC2, RFC4, RPAP3, RUVBL2, UNC119
• Immunogen: The immunogen for anti-IFI44L antibody: synthetic peptide directed towards the N terminal of human IFI44L
• Product Format: Lyophilized powder
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Human: 92%
• Peptide Sequence: Synthetic peptide located within the following region: MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT
• Blocking Peptide: For anti-IFI44L antibody is Catalog # AAP46166 (Previous Catalog # AAPP27004)
• Additional Information: IHC Information: Jurkat cell lysate. Antibody concentration: 5.0 ug/ml. Gel concentration: 12%.
• Key Reference: Suzuki,Y., Gene 200 (1-2), 149-156 (1997)
• Reconstitution and Storage: Add 100 μl of distilled water. Final anti-IFI44L antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: IFI44L antibody tested by IHC with human kidney (ARP46166)

Aviva Systems Biology is the original manufacturer of this IFI44L antibody.

Click here to view the IFI44L antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: IFI44L antibody (ARP46166)

IHC Information:

Rabbit Anti-IFI44L Antibody
Catalog Number: ARP46166
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image: