ESR2 antibody - N-terminal region (ARP31652_P050)

Catalog#: ARP31652_P050

• Size: 50ug

Human HepG2

• Description of Target: ESR2 is a member of the family of estrogen receptors and superfamily of nuclear receptor transcription factors. The gene product contains an N-terminal DNA binding domain and C-terminal ligand binding domain and is localized to the nucleus, cytoplasm, and mitochondria. Upon binding to 17beta-estradiol or related ligands, the encoded protein forms homo- or hetero-dimers that interact with specific DNA sequences to activate transcription. Some isoforms dominantly inhibit the activity of other estrogen receptor family members. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been fully characterized.
• Gene Symbol: ESR2
• Official Gene Full Name: Estrogen receptor 2 (ER beta)
• Alias Symbols: Erb; ESRB; ESTRB; NR3A2; ER-BETA; ESR-BETA
• Protein Accession#: NP_001428
• Nucleotide Accession#: NM_001437
• Swissprot Id: Q92731
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 530
• Molecular Weight: 59kDa
• Specificity: Directed towards isoforms 1-8.
• Application: WB
• Immunogen: The immunogen for anti-ESR2 antibody: synthetic peptide directed towards the N terminal of human ESR2
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Dog: 92%; Guinea pig: 92%; Sheep: 92%; Rabbit: 84%
• Peptide Sequence: Synthetic peptide located within the following region: TPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGN
• Blocking Peptide: For anti-ESR2 antibody is Catalog # AAP31652 (Previous Catalog # AAPP02439)
• Key Reference: Rothwarf,D.M., et al., (2006) J. Endocrinol. Invest. 29 (1), 5-10
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-ESR2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: ESR2 antibody tested with Human Hepg2 Cells (ARP31652_P050)

Aviva Systems Biology is the original manufacturer of this ESR2 antibody (ARP31652_P050)

Click here to view the ESR2 antibody Western Blot Protocol

Product Datasheet Link: ESR2 antibody (ARP31652_P050)

WB Suggested Anti-ESR2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2

Western Blot image:


Description of Target: ESR2 is a member of the family of estrogen receptors and superfamily of nuclear receptor transcription factors. The gene product contains an N-terminal DNA binding domain and C-terminal ligand binding domain and is localized to the nucleus, cytoplasm, and mitochondria. Upon binding to 17beta-estradiol or related ligands, the encoded protein forms homo- or hetero-dimers that interact with specific DNA sequences to activate transcription. Some isoforms dominantly inhibit the activity of other estrogen receptor family members. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been fully characterized.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s ESR2 antibody (ARP31652_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com