EAP30 antibody - N-terminal region (ARP31531_P050)

Catalog#: ARP31531_P050

• Size: 50ug

Human HepG2

Human Spleen

Human Heart

Human Stomach

• Description of Target: ELL encodes an RNA polymerase II transcription factor that undergoes frequent translocation in acute myeloid leukemia (AML). In addition to its elongation activity, ELL contains a novel type of RNA polymerase II interaction domain that is capable of repressing polymerase activity in promoter-specific transcription. EAP30 is a subunit of the ELL complex. EAP30 can interact with ELL and derepress ELL's inhibitory activity in vitro.SNF8, VPS25 (MIM 610907), and VPS36 (MIM 610903) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with RNA polymerase II elongation factor (ELL; MIM 600284) (Slagsvold et al., 2005 [PubMed 15755741]; Kamura et al., 2001 [PubMed 11278625]).[supplied by OMIM].
• Gene Symbol: EAP30
• Official Gene Full Name: SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae)
• Alias Symbols: Dot3; EAP30; VPS22
• Protein Accession#: NP_009172
• Nucleotide Accession#: NM_007241
• Swissprot Id: Q96H20
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 258
• Molecular Weight: 29kDa
• Application: WB, IHC
• Partner Proteins: CTBP2, FHL3, CTBP2
• Immunogen: The immunogen for anti-EAP30 antibody: synthetic peptide directed towards the N terminal of human EAP30
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: African clawed frog:100%; Western clawed frog:100%; Bovine:100%; Channel catfish:100%; blue catfish:100%; Dog:100%; Chicken:100%; Rat:100%; Atlantic salmon:100%; Mouse:100%; Human:100%; Japanese pufferfish:92%; Zebrafish:92%; Florida lancelet:83%; 
• Peptide Sequence: Synthetic peptide located within the following region: MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEF
• Blocking Peptide: For anti-EAP30 antibody is Catalog # AAP31531 (Previous Catalog # AAPS26305)
• Additional Information: IHC Information: Human Heart: Formalin-Fixed, Paraffin-Embedded (FFPE)
  IHC Information: Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
• Key Reference: Schmidt,A.E., et al., (1999) Biol. Chem. 274 (31), 21981-21985
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-EAP30 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: EAP30 antibody tested by IHC with human stomach (ARP31531)

Aviva Systems Biology is the original manufacturer of this EAP30 antibody.

Click here to view the EAP30 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: EAP30 antibody (ARP31531)

IHC Information:

Rabbit Anti-EAP30 Antibody
Catalog Number: ARP31531
Paraffin Embedded Tissue: Human Stomach
Cellular Data: Epithelial cells of Fundic Gland and Surface Mucous Cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image: