website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TCF7L1 antibody - N-terminal region (ARP57917_P050)

  • Catalog#: ARP57917_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Free trial-size samples may be available for this item. Please go here for more information.
Print Page
100 ul
    $289.00
    In Stock
    Free trial-size samples may be available for this item. Please go here for more information.
    Gene Symbol:
    TCF7L1
    NCBI Gene Id:
    83439
    Official Gene Full Name:
    Transcription factor 7-like 1 (T-cell specific, HMG-box)
    Protein Name:
    Transcription factor 7-like 1
    Swissprot Id:
    Q9HCS4
    Protein Accession #:
    NP_112573
    Nucleotide Accession #:
    NM_031283
    Alias Symbols:
    TCF-3, TCF3
    Replacement Item:
    This antibody may replace item sc-12491 from Santa Cruz Biotechnology.
    Description of Target:
    TCF7L1 participates in the Wnt signaling pathway. It binds to DNA and acts as a repressor in the absence of CTNNB1, and as an activator in its presence. It is necessary for the terminal differentiation of epidermal cells, the formation of keratohyalin granules and the development of the barrier function of the epidermis. TCF7L1 down-regulates NQO1, leading to increased mitomycin c resistance.
    Protein Size (# AA):
    588
    Molecular Weight:
    63kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express TCF7L1.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express TCF7L1.
    Immunogen:
    The immunogen is a synthetic peptide directed towards the N terminal region of human TCF7L1
    Species Reactivity:
    Cow, Dog, Human, Mouse, Rabbit, Rat
    Predicted Homology Based on Immunogen Sequence:
    Cow: 86%; Dog: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%
    Complete computational species homology data:
    Anti-TCF7L1 (ARP57917_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: ESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYPG
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    UBC; mdfic; Mdfi; DAZAP2; CTNNB1;
    Blocking Peptide:
    For anti-TCF7L1 (ARP57917_P050) antibody is Catalog # AAP57917 (Previous Catalog # AAPP32328)
    Datasheets / Downloads:
    Printable datasheet for anti-TCF7L1 (ARP57917_P050) antibody
    Target Reference:
    Hillier,L.W., (2005) Nature 434 (7034), 724-731

    Product Protocols: TCF7L1 antibody tested with Human 293T Cells (ARP57917_P050)

    Aviva Systems Biology is the original manufacturer of this TCF7L1 antibody (ARP57917_P050)

    Click here to view the TCF7L1 antibody Western Blot Protocol

    Product Datasheet Link: TCF7L1 antibody (ARP57917_P050)

    WB Suggested Anti-TCF7L1 Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:1562500
    Positive Control: 293T

    Western Blot image:


    Description of Target: TCF7L1 participates in the Wnt signaling pathway. It binds to DNA and acts as a repressor in the absence of CTNNB1, and as an activator in its presence. It is necessary for the terminal differentiation of epidermal cells, the formation of keratohyalin granules and the development of the barrier function of the epidermis. TCF7L1 down-regulates NQO1, leading to increased mitomycin c resistance.

    Questions pertaining to this data can be directed to techsupport@avivasysbio.com

    Aviva Systems Biology’s TCF7L1 antibody (ARP57917_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

     
    X
    Ask a Question