website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SRD5A2 antibody - N-terminal region (ARP44264_P050)

  • Catalog#: ARP44264_P050
  • Domestic: within 1-2 days delivery International: 1-2 days
    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges
    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Print Page
100 ul
    In Stock

    Conjugation Options

    ARP44264_P050-FITC Conjugated

    ARP44264_P050-HRP Conjugated

    ARP44264_P050-Biotin Conjugated

    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    Steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
    Protein Name:
    3-oxo-5-alpha-steroid 4-dehydrogenase 2
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    Replacement Item:
    This antibody may replace item sc-20400 from Santa Cruz Biotechnology.
    Description of Target:
    This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result
    Protein Size (# AA):
    Molecular Weight:
    Affinity Purified
    IHC, WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express SRD5A2.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express SRD5A2.
    The immunogen is a synthetic peptide directed towards the N terminal region of human SRD5A2
    Species Reactivity:
    Human, Pig, Rabbit
    Predicted Homology Based on Immunogen Sequence:
    Human: 100%; Pig: 86%; Rabbit: 91%
    Complete computational species homology data:
    Anti-SRD5A2 (ARP44264_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Blocking Peptide:
    For anti-SRD5A2 (ARP44264_P050) antibody is Catalog # AAP44264 (Previous Catalog # AAPP25644)
    Datasheets / Downloads:
    Printable datasheet for anti-SRD5A2 (ARP44264_P050) antibody

    Product Protocols: SRD5A2 antibody tested with Human Thp-1 Cells (ARP44264_P050)

    Aviva Systems Biology is the original manufacturer of this SRD5A2 antibody (ARP44264_P050)

    Click here to view the SRD5A2 antibody Western Blot Protocol

    Product Datasheet Link: SRD5A2 antibody (ARP44264_P050)

    WB Suggested Anti-SRD5A2 Antibody Titration: 0.2-1 ug/ml
    Positive Control: THP-1

    Western Blot image:

    Description of Target: This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result

    Questions pertaining to this data can be directed to

    Aviva Systems Biology’s SRD5A2 antibody (ARP44264_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

    Product Review: SRD5A2 antibody - N-terminal region (ARP44264_P050) in Monkey vagina using IHC

    Product Page for SRD5A2 antibody - N-terminal region (ARP44264_P050)

    Researcher: Jonathan Bertin, Endoceutics Inc.
    Application: IHC
    Species+tissue/cell type: Monkey vagina
    Primary antibody dilution: 1:25
    Secondary antibody: Anti-rabbit-HRP
    Secondary antibody dilution: 1:1000

    How do Aviva’s reagents play a role in your experimental goals?Permits us to test rare antibodies directed against monkey proteins. Since homology between monkey and human is very high, Aviva's antibodies work quite well for our purposes.
    How would you rate this antibody on a scale from 1-5 (5=best) and why?4
    Would you use this antibody in future experiments?Yes
    Have you used another antibody which has worked in your application?Yes
    Do you believe the information about the reagent on Aviva’s website is correct?Yes
    If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not?Yes. Although background, other  in house Ab revealed samle locolization.
    How did you store the antibody after re-suspension?4 degree celcius
    Sample Description (please include species type and tissue/cell type):Monkey (Macaqua fasicularis)/vagina/adrenal gland
    How many different experimental trials were conducted using the antibody sample?2
    From your IHC/ICC images, briefly explain the colors of each stain and counterstain:Redish =signal of precipitate at site of primary Ab fixation. Blueish = no signal, only hematoxylin.
    Did you use an antigen retrieval method? If so, please explain?No
    What controls were used in your experiment?Only secondary Ab
    Please include your detailed tissue preparation and staining procedure/protocol here:Immunohistochemistry. Paraffin sections (5-mm thick) were deparaffinized, hydrated, and treated with 3% H2O2 in methanol for 20 min. The sections were blocked (1% BSA, 0.1% Tween-20 and 10% normal rabbit serum) before incubation overnight at 4C with our in-house antibody at a dilution of 1/2000 in blocking solution. A commercial detection system kit (Covance Research Products, Inc, Deham, Massachusetts) using streptavidin-biotin amplication method was then used. Finally, the antigen-antibody complex was visualized with a solution of PBS 1X containing 5 mg/ml of 3,3-diaminobenzidine and 0.012% H2O2. Sections were lightly counterstained with hematoxylin. Negative controls were done by incubating tissues with normal rabbit serum. Images were generated utilizing a 10X objective on the Leica DMRB.

    Product Review: SRD5A2 antibody - N-terminal region (ARP44264_P050) in Monkey adrenal gland using IHC

    Product Page for SRD5A2 antibody - N-terminal region (ARP44264_P050)

    Researcher: Jonathan Bertin, Endoceutics Inc.
    Application: IHC
    Species+tissue/cell type: Monkey adrenal gland
    Primary antibody dilution: 1:25
    Secondary antibody: Anti-rabbit-HRP
    Secondary antibody dilution: 1:1000

    How do Aviva’s reagents play a role in your experimental goals?Permits us to test rare antibodies directed against monkey proteins. Since homology between monkey and human is very high, Aviva's antibodies work quite well for our purposes.
    How would you rate this antibody on a scale from 1-5 (5=best) and why?4
    Would you use this antibody in future experiments?Yes
    Have you used another antibody which has worked in your application?Yes
    Do you believe the information about the reagent on Aviva’s website is correct?Yes
    If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not?Yes. Although background, other  in house Ab revealed samle locolization.
    How did you store the antibody after re-suspension?4 degree celcius
    Sample Description (please include species type and tissue/cell type):Monkey (Macaqua fasicularis)/vagina/adrenal gland
    How many different experimental trials were conducted using the antibody sample?2
    From your IHC/ICC images, briefly explain the colors of each stain and counterstain:Redish =signal of precipitate at site of primary Ab fixation. Blueish = no signal, only hematoxylin.
    Did you use an antigen retrieval method? If so, please explain?No
    What controls were used in your experiment?Only secondary Ab
    Please include your detailed tissue preparation and staining procedure/protocol here:Immunohistochemistry. Paraffin sections (5-mm thick) were deparaffinized, hydrated, and treated with 3% H2O2 in methanol for 20 min. The sections were blocked (1% BSA, 0.1% Tween-20 and 10% normal rabbit serum) before incubation overnight at 4C with our in-house antibody at a dilution of 1/2000 in blocking solution. A commercial detection system kit (Covance Research Products, Inc, Deham, Massachusetts) using streptavidin-biotin amplication method was then used. Finally, the antigen-antibody complex was visualized with a solution of PBS 1X containing 5 mg/ml of 3,3-diaminobenzidine and 0.012% H2O2. Sections were lightly counterstained with hematoxylin. Negative controls were done by incubating tissues with normal rabbit serum. Images were generated utilizing a 10X objective on the Leica DMRB.
    Ask a Question