website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

E2F2 antibody - middle region (ARP38418_P050)

  • Catalog#: ARP38418_P050
  • Domestic: within 1-2 days delivery International: 1-2 days
    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges
    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Free trial-size samples may be available for this item. Please go here for more information.
Print Page
100 ul
    $289.00
    In Stock

    Conjugation Options

    ARP38418_P050-FITC Conjugated

    ARP38418_P050-HRP Conjugated

    ARP38418_P050-Biotin Conjugated

    Free trial-size samples may be available for this item. Please go here for more information.
    Gene Symbol:
    E2F2
    NCBI Gene Id:
    1870
    Official Gene Full Name:
    E2F transcription factor 2
    Protein Name:
    Transcription factor E2F2
    Swissprot Id:
    Q14209
    Protein Accession #:
    NP_004082
    Nucleotide Accession #:
    NM_004091
    Alias Symbols:
    E2F-2
    Replacement Item:
    This antibody may replace item sc-22821 from Santa Cruz Biotechnology.
    Description of Target:
    E2F2 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1.The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
    Protein Size (# AA):
    437
    Molecular Weight:
    47kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    IHC, WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express E2F2.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express E2F2.
    Immunogen:
    The immunogen is a synthetic peptide directed towards the middle region of human E2F2
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
    Predicted Homology Based on Immunogen Sequence:
    Cow: 92%; Dog: 100%; Guinea Pig: 91%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 75%
    Complete computational species homology data:
    Anti-E2F2 (ARP38418_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: DQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLI
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    RB1; GNB5; GIT2; TFDP1; RBL1; ARID3A; ELAVL1; ATAD2; KMT2D; KMT2A; RYBP; SETD8; BCAR1; TFDP2; BRD2; YY1; SP1; CDK3; RNF144A; FHL2; SPIB; RBL2; E2F4; MYBL2; EAPP; TP53BP2; PPP1R13B; TP53INP1; JMY; GAB2; CDC25A; CDC6; E2F1; UXT; MT1G;
    Blocking Peptide:
    For anti-E2F2 (ARP38418_P050) antibody is Catalog # AAP38418 (Previous Catalog # AAPP20608)
    Datasheets / Downloads:
    Printable datasheet for anti-E2F2 (ARP38418_P050) antibody
    Target Reference:
    Raj,D., (2008) Carcinogenesis 29 (1), 194-201

    Product Protocols: E2F2 antibody tested with Human Fetal Brain Tissue (ARP38418_P050)

    Aviva Systems Biology is the original manufacturer of this E2F2 antibody (ARP38418_P050)

    Click here to view the E2F2 antibody Western Blot Protocol

    Product Datasheet Link: E2F2 antibody (ARP38418_P050)

    WB Suggested Anti-E2F2 Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:1562500
    Positive Control: Fetal Brain

    Western Blot image:


    Description of Target: E2F2 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1.The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

    Questions pertaining to this data can be directed to techsupport@avivasysbio.com

    Aviva Systems Biology’s E2F2 antibody (ARP38418_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

     
    X
    Ask a Question