website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

TCF7L1 antibody - N-terminal region (ARP57917_P050)

Description of Target:
TCF7L1 participates in the Wnt signaling pathway. It binds to DNA and acts as a repressor in the absence of CTNNB1, and as an activator in its presence. It is necessary for the terminal differentiation of epidermal cells, the formation of keratohyalin granules and the development of the barrier function of the epidermis. TCF7L1 down-regulates NQO1, leading to increased mitomycin c resistance.
Gene Symbol:
Official Gene Full Name:
Transcription factor 7-like 1 (T-cell specific, HMG-box)
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express TCF7L1.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Transcription factor 7-like 1
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-TCF7L1 antibody: synthetic peptide directed towards the N terminal of human TCF7L1
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
TCF7L1 antibody - N-terminal region (ARP57917_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Dog: 86%; Rat: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%
Species Reactivity:
Human, Mouse, Rat, Bovine, Dog, Rabbit
Datasheets / Downloads:
Printable datasheet for
anti-TCF7L1 antibody
- ARP57917_P050
Peptide Sequence:
Synthetic peptide located within the following region: ESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYPG
Blocking Peptide:
For anti-TCF7L1 antibody is Catalog # AAP57917 (Previous Catalog # AAPP32328)
Key Reference:
Hillier,L.W., (2005) Nature 434 (7034), 724-731
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-TCF7L1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question