website statistics
Account Login 

Aviva Systems Biology office will be closed for Memorial Day - 5/25/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

TCF7L1 antibody - N-terminal region (ARP57917_P050)

Description of Target:
TCF7L1 participates in the Wnt signaling pathway. It binds to DNA and acts as a repressor in the absence of CTNNB1, and as an activator in its presence. It is necessary for the terminal differentiation of epidermal cells, the formation of keratohyalin granules and the development of the barrier function of the epidermis. TCF7L1 down-regulates NQO1, leading to increased mitomycin c resistance.
Gene Symbol:
Official Gene Full Name:
Transcription factor 7-like 1 (T-cell specific, HMG-box)
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TCF7L1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TCF7L1.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
Transcription factor 7-like 1
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
UBC; mdfic; Mdfi; DAZAP2; CTNNB1;
The immunogen for anti-TCF7L1 antibody: synthetic peptide directed towards the N terminal of human TCF7L1
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
TCF7L1 antibody - N-terminal region (ARP57917_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Dog: 86%; Rat: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%
Species Reactivity:
Human, Mouse, Rat, Bovine, Dog, Rabbit
Datasheets / Downloads:
Printable datasheet for
anti-TCF7L1 antibody
- ARP57917_P050
Peptide Sequence:
Synthetic peptide located within the following region: ESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYPG
Blocking Peptide:
For anti-TCF7L1 antibody is Catalog # AAP57917 (Previous Catalog # AAPP32328)
Target Reference:
Hillier,L.W., (2005) Nature 434 (7034), 724-731
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for TCF7L1 antibody (ARP57917)

Product page for TCF7L1 antibody (ARP57917)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant TCF7L1 antibody; Loxodonta africana TCF7L1 antibody G3U0J4 85%
African elephant TCF7L1 antibody; Loxodonta africana TCF7L1 antibody G3TGP4 85%
Bovine Bt.44249 antibody; Bos taurus Bt.44249 antibody F1MRT2 85%
Bovine Bt.44249 antibody; Bos taurus Bt.44249 antibody F1MPE6 85%
Bovine BT.44249 antibody; Bos taurus BT.44249 antibody F1MJN6 85%
Gray short-tailed opossum TCF7L1 antibody; Monodelphis domestica TCF7L1 antibody F7AIP6 78%
Human TCF7L1 antibody; Homo sapiens TCF7L1 antibody Q53T87 100%
Human TF7L1 antibody; Homo sapiens TF7L1 antibody Q9HCS4 100%
Lowland gorilla TCF7L1 antibody; Gorilla gorilla gorilla TCF7L1 antibody G3QZP8 92%
Mouse Tcf7l1 antibody; Mus musculus Tcf7l1 antibody A1A550 85%
Mouse Tcf7l1 antibody; Mus musculus Tcf7l1 antibody A1A549 85%
Mouse TF7L1 antibody; Mus musculus TF7L1 antibody Q9Z1J1 85%
Northern white-cheeked gibbon TCF7L1 antibody; Nomascus leucogenys TCF7L1 antibody G1QLB0 92%
Rabbit TCF7L1 antibody; Oryctolagus cuniculus TCF7L1 antibody G1SVT7 85%
Rhesus macaque TCF7L1 antibody; Macaca mulatta TCF7L1 antibody F6U055 92%
Small-eared galago TCF7L1 antibody; Otolemur garnettii TCF7L1 antibody H0WHU3 85%
White-tufted-ear marmoset TCF7L1 antibody; Callithrix jacchus TCF7L1 antibody F7H1K8 85%
White-tufted-ear marmoset TCF7L1 antibody; Callithrix jacchus TCF7L1 antibody F6XER4 85%

Product Protocols: TCF7L1 antibody tested with Human 293T Cells (ARP57917_P050)

Aviva Systems Biology is the original manufacturer of this TCF7L1 antibody (ARP57917_P050)

Click here to view the TCF7L1 antibody Western Blot Protocol

Product Datasheet Link: TCF7L1 antibody (ARP57917_P050)

WB Suggested Anti-TCF7L1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T

Western Blot image:

Description of Target: TCF7L1 participates in the Wnt signaling pathway. It binds to DNA and acts as a repressor in the absence of CTNNB1, and as an activator in its presence. It is necessary for the terminal differentiation of epidermal cells, the formation of keratohyalin granules and the development of the barrier function of the epidermis. TCF7L1 down-regulates NQO1, leading to increased mitomycin c resistance.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s TCF7L1 antibody (ARP57917_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question