website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

SRD5A2 antibody - N-terminal region (ARP44264_P050)

Description of Target:
This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result
Gene Symbol:
Official Gene Full Name:
Steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SRD5A2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SRD5A2.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
3-oxo-5-alpha-steroid 4-dehydrogenase 2
Protein Size (# AA):
Molecular Weight:
The immunogen is a synthetic peptide directed towards the N terminal region of human SRD5A2
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
Anti-SRD5A2 (ARP44264_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 86%; Rabbit: 91%
Species Reactivity:
Human; Pig; Rabbit
Datasheets / Downloads:
Printable datasheet for anti-SRD5A2 (ARP44264_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR
Blocking Peptide:
For anti-SRD5A2 (ARP44264_P050) antibody is Catalog # AAP44264 (Previous Catalog # AAPP25644)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: SRD5A2 antibody tested with Human Thp-1 Cells (ARP44264_P050)

Aviva Systems Biology is the original manufacturer of this SRD5A2 antibody (ARP44264_P050)

Click here to view the SRD5A2 antibody Western Blot Protocol

Product Datasheet Link: SRD5A2 antibody (ARP44264_P050)

WB Suggested Anti-SRD5A2 Antibody Titration: 0.2-1 ug/ml
Positive Control: THP-1

Western Blot image:

Description of Target: This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result

Questions pertaining to this data can be directed to

Aviva Systems Biology’s SRD5A2 antibody (ARP44264_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Review: SRD5A2 antibody - N-terminal region (ARP44264_P050) in Monkey vagina using IHC

Product Page for SRD5A2 antibody - N-terminal region (ARP44264_P050)

Researcher: Jonathan Bertin, Endoceutics Inc.
Application: IHC
Species+tissue/cell type: Monkey vagina
Primary antibody dilution: 1:25
Secondary antibody: Anti-rabbit-HRP
Secondary antibody dilution: 1:1000

How do Aviva’s reagents play a role in your experimental goals? Permits us to test rare antibodies directed against monkey proteins. Since homology between monkey and human is very high, Aviva's antibodies work quite well for our purposes.
How would you rate this antibody on a scale from 1-5 (5=best) and why? 4
Would you use this antibody in future experiments? Yes
Have you used another antibody which has worked in your application? Yes
Do you believe the information about the reagent on Aviva’s website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes. Although background, other  in house Ab revealed samle locolization.
How did you store the antibody after re-suspension? 4 degree celcius
Sample Description (please include species type and tissue/cell type): Monkey (Macaqua fasicularis)/vagina/adrenal gland
How many different experimental trials were conducted using the antibody sample? 2
From your IHC/ICC images, briefly explain the colors of each stain and counterstain: Redish =signal of precipitate at site of primary Ab fixation. Blueish = no signal, only hematoxylin.
Did you use an antigen retrieval method? If so, please explain? No
What controls were used in your experiment? Only secondary Ab
Please include your detailed tissue preparation and staining procedure/protocol here: Immunohistochemistry. Paraffin sections (5-mm thick) were deparaffinized, hydrated, and treated with 3% H2O2 in methanol for 20 min. The sections were blocked (1% BSA, 0.1% Tween-20 and 10% normal rabbit serum) before incubation overnight at 4C with our in-house antibody at a dilution of 1/2000 in blocking solution. A commercial detection system kit (Covance Research Products, Inc, Deham, Massachusetts) using streptavidin-biotin amplication method was then used. Finally, the antigen-antibody complex was visualized with a solution of PBS 1X containing 5 mg/ml of 3,3-diaminobenzidine and 0.012% H2O2. Sections were lightly counterstained with hematoxylin. Negative controls were done by incubating tissues with normal rabbit serum. Images were generated utilizing a 10X objective on the Leica DMRB.

Product Review: SRD5A2 antibody - N-terminal region (ARP44264_P050) in Monkey adrenal gland using IHC

Product Page for SRD5A2 antibody - N-terminal region (ARP44264_P050)

Researcher: Jonathan Bertin, Endoceutics Inc.
Application: IHC
Species+tissue/cell type: Monkey adrenal gland
Primary antibody dilution: 1:25
Secondary antibody: Anti-rabbit-HRP
Secondary antibody dilution: 1:1000

How do Aviva’s reagents play a role in your experimental goals? Permits us to test rare antibodies directed against monkey proteins. Since homology between monkey and human is very high, Aviva's antibodies work quite well for our purposes.
How would you rate this antibody on a scale from 1-5 (5=best) and why? 4
Would you use this antibody in future experiments? Yes
Have you used another antibody which has worked in your application? Yes
Do you believe the information about the reagent on Aviva’s website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes. Although background, other  in house Ab revealed samle locolization.
How did you store the antibody after re-suspension? 4 degree celcius
Sample Description (please include species type and tissue/cell type): Monkey (Macaqua fasicularis)/vagina/adrenal gland
How many different experimental trials were conducted using the antibody sample? 2
From your IHC/ICC images, briefly explain the colors of each stain and counterstain: Redish =signal of precipitate at site of primary Ab fixation. Blueish = no signal, only hematoxylin.
Did you use an antigen retrieval method? If so, please explain? No
What controls were used in your experiment? Only secondary Ab
Please include your detailed tissue preparation and staining procedure/protocol here: Immunohistochemistry. Paraffin sections (5-mm thick) were deparaffinized, hydrated, and treated with 3% H2O2 in methanol for 20 min. The sections were blocked (1% BSA, 0.1% Tween-20 and 10% normal rabbit serum) before incubation overnight at 4C with our in-house antibody at a dilution of 1/2000 in blocking solution. A commercial detection system kit (Covance Research Products, Inc, Deham, Massachusetts) using streptavidin-biotin amplication method was then used. Finally, the antigen-antibody complex was visualized with a solution of PBS 1X containing 5 mg/ml of 3,3-diaminobenzidine and 0.012% H2O2. Sections were lightly counterstained with hematoxylin. Negative controls were done by incubating tissues with normal rabbit serum. Images were generated utilizing a 10X objective on the Leica DMRB.
Ask a Question