- Description of Target:
- This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result
- Gene Symbol:
- SRD5A2
- Official Gene Full Name:
- Steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
- Alias Symbols:
- MGC138457
- Tissue Tool:
- Find tissues and cell lines supported to express SRD5A2.
- Protein Accession# :
- NP_000339
- Nucleotide Accession#:
- NM_000348
- Swissprot Id:
- Q28892
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 254
- Molecular Weight:
- 28kDa
- Application:
- WB
- Partner Proteins:
- A2M, COL1A1, COL1A2, COL2A1, COL4A1, COL4A2, COL4A3, COL4A4, FN1, FN1
- Immunogen:
- The immunogen for anti-SRD5A2 antibody: synthetic peptide directed towards the N terminal of human SRD5A2
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- SRD5A2 antibody - N-terminal region (ARP44264_P050)
- Datasheets / Downloads:
- Printable datasheet for
anti-SRD5A2 antibody
- ARP44264_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR
- Blocking Peptide:
- For anti-SRD5A2 antibody is Catalog # AAP44264 (Previous Catalog # AAPP25644)
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-SRD5A2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: SRD5A2 antibody tested with Human Thp-1 Cells (ARP44264_P050)
Aviva Systems Biology is the original manufacturer of this SRD5A2 antibody (ARP44264_P050)
Click here to view the SRD5A2 antibody Western Blot Protocol
Product Datasheet Link: SRD5A2 antibody (ARP44264_P050)
WB Suggested Anti-SRD5A2 Antibody Titration: 0.2-1 ug/ml
Positive Control: THP-1
Western Blot image: 
Description of Target: This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s SRD5A2 antibody (ARP44264_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
