website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

SRD5A2 antibody - N-terminal region (ARP44264_P050)

Description of Target:
This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result
Gene Symbol:
Official Gene Full Name:
Steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express SRD5A2.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
3-oxo-5-alpha-steroid 4-dehydrogenase 2
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
A2M, COL1A1, COL1A2, COL2A1, COL4A1, COL4A2, COL4A3, COL4A4, FN1, FN1
The immunogen for anti-SRD5A2 antibody: synthetic peptide directed towards the N terminal of human SRD5A2
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
SRD5A2 antibody - N-terminal region (ARP44264_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Rabbit: 91%; Pig: 86%
Species Reactivity:
Human, Rabbit, Pig
Datasheets / Downloads:
Printable datasheet for
anti-SRD5A2 antibody
- ARP44264_P050
Peptide Sequence:
Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR
Blocking Peptide:
For anti-SRD5A2 antibody is Catalog # AAP44264 (Previous Catalog # AAPP25644)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-SRD5A2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question