website statistics
Account Login 

Aviva Systems Biology office will be closed for Christmas and New Year holidays - 12/24/2014, 12/25/2014 and 1/1/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

SRD5A2 antibody - N-terminal region (ARP44264_P050)

Description of Target:
This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result
Gene Symbol:
SRD5A2
Official Gene Full Name:
Steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
NCBI Gene Id:
6716
Alias Symbols:
MGC138457
Tissue Tool:
Find tissues and cell lines supported to express SRD5A2.
Protein Accession #:
NP_000339
Nucleotide Accession#:
NM_000348
Swissprot Id:
Q28892
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
3-oxo-5-alpha-steroid 4-dehydrogenase 2
Protein Size (# AA):
254
Molecular Weight:
28kDa
Application:
IHC, WB
Partner Proteins:
A2M, COL1A1, COL1A2, COL2A1, COL4A1, COL4A2, COL4A3, COL4A4, FN1, FN1
Immunogen:
The immunogen for anti-SRD5A2 antibody: synthetic peptide directed towards the N terminal of human SRD5A2
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
SRD5A2 antibody - N-terminal region (ARP44264_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Rabbit: 91%; Pig: 86%
Species Reactivity:
Human, Rabbit, Pig
Datasheets / Downloads:
Printable datasheet for
anti-SRD5A2 antibody
- ARP44264_P050
Peptide Sequence:
Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR
Blocking Peptide:
For anti-SRD5A2 antibody is Catalog # AAP44264 (Previous Catalog # AAPP25644)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-SRD5A2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for SRD5A2 antibody (ARP44264)

Product page for SRD5A2 antibody (ARP44264)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Crab-eating macaque S5A2 antibody; Macaca fascicularis S5A2 antibody Q28892 100%
Giant panda LOC100466687 antibody; Ailuropoda melanoleuca LOC100466687 antibody G1LCL9 78%
Human S5A2 antibody; Homo sapiens S5A2 antibody P31213 100%
Lowland gorilla ENSG00000049319 antibody; Gorilla gorilla gorilla ENSG00000049319 antibody G3SG98 92%
Lowland gorilla ENSG00000049319 antibody; Gorilla gorilla gorilla ENSG00000049319 antibody G3RPI7 92%
Lowland gorilla ENSG00000049319 antibody; Gorilla gorilla gorilla ENSG00000049319 antibody G3RDE1 91%
Northern white-cheeked gibbon LOC100597634 antibody; Nomascus leucogenys LOC100597634 antibody G1S057 92%
Pig S5A2 antibody; Sus scrofa S5A2 antibody O18765 85%
Rhesus macaque SRD5A2 antibody; Macaca mulatta SRD5A2 antibody F6QL58 100%

Product Protocols: SRD5A2 antibody tested with Human Thp-1 Cells (ARP44264_P050)

Aviva Systems Biology is the original manufacturer of this SRD5A2 antibody (ARP44264_P050)

Click here to view the SRD5A2 antibody Western Blot Protocol

Product Datasheet Link: SRD5A2 antibody (ARP44264_P050)

WB Suggested Anti-SRD5A2 Antibody Titration: 0.2-1 ug/ml
Positive Control: THP-1

Western Blot image:


Description of Target: This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s SRD5A2 antibody (ARP44264_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Review: SRD5A2 antibody - N-terminal region (ARP44264_P050) in Monkey vagina using IHC

Product Page for SRD5A2 antibody - N-terminal region (ARP44264_P050)

Researcher: Jonathan Bertin, Endoceutics Inc.
Application: IHC
Species+tissue/cell type: Monkey vagina
Primary antibody dilution: 1:25
Secondary antibody: Anti-rabbit-HRP
Secondary antibody dilution: 1:1000

Questionnaire:
How do Aviva’s reagents play a role in your experimental goals? Permits us to test rare antibodies directed against monkey proteins. Since homology between monkey and human is very high, Aviva's antibodies work quite well for our purposes.
How would you rate this antibody on a scale from 1-5 (5=best) and why? 4
Would you use this antibody in future experiments? Yes
Have you used another antibody which has worked in your application? Yes
Do you believe the information about the reagent on Aviva’s website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes. Although background, other  in house Ab revealed samle locolization.
How did you store the antibody after re-suspension? 4 degree celcius
Sample Description (please include species type and tissue/cell type): Monkey (Macaqua fasicularis)/vagina/adrenal gland
How many different experimental trials were conducted using the antibody sample? 2
From your IHC/ICC images, briefly explain the colors of each stain and counterstain: Redish =signal of precipitate at site of primary Ab fixation. Blueish = no signal, only hematoxylin.
Did you use an antigen retrieval method? If so, please explain? No
What controls were used in your experiment? Only secondary Ab
Please include your detailed tissue preparation and staining procedure/protocol here: Immunohistochemistry. Paraffin sections (5-mm thick) were deparaffinized, hydrated, and treated with 3% H2O2 in methanol for 20 min. The sections were blocked (1% BSA, 0.1% Tween-20 and 10% normal rabbit serum) before incubation overnight at 4C with our in-house antibody at a dilution of 1/2000 in blocking solution. A commercial detection system kit (Covance Research Products, Inc, Deham, Massachusetts) using streptavidin-biotin amplication method was then used. Finally, the antigen-antibody complex was visualized with a solution of PBS 1X containing 5 mg/ml of 3,3-diaminobenzidine and 0.012% H2O2. Sections were lightly counterstained with hematoxylin. Negative controls were done by incubating tissues with normal rabbit serum. Images were generated utilizing a 10X objective on the Leica DMRB.

Product Review: SRD5A2 antibody - N-terminal region (ARP44264_P050) in Monkey adrenal gland using IHC

Product Page for SRD5A2 antibody - N-terminal region (ARP44264_P050)

Researcher: Jonathan Bertin, Endoceutics Inc.
Application: IHC
Species+tissue/cell type: Monkey adrenal gland
Primary antibody dilution: 1:25
Secondary antibody: Anti-rabbit-HRP
Secondary antibody dilution: 1:1000

Questionnaire:
How do Aviva’s reagents play a role in your experimental goals? Permits us to test rare antibodies directed against monkey proteins. Since homology between monkey and human is very high, Aviva's antibodies work quite well for our purposes.
How would you rate this antibody on a scale from 1-5 (5=best) and why? 4
Would you use this antibody in future experiments? Yes
Have you used another antibody which has worked in your application? Yes
Do you believe the information about the reagent on Aviva’s website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes. Although background, other  in house Ab revealed samle locolization.
How did you store the antibody after re-suspension? 4 degree celcius
Sample Description (please include species type and tissue/cell type): Monkey (Macaqua fasicularis)/vagina/adrenal gland
How many different experimental trials were conducted using the antibody sample? 2
From your IHC/ICC images, briefly explain the colors of each stain and counterstain: Redish =signal of precipitate at site of primary Ab fixation. Blueish = no signal, only hematoxylin.
Did you use an antigen retrieval method? If so, please explain? No
What controls were used in your experiment? Only secondary Ab
Please include your detailed tissue preparation and staining procedure/protocol here: Immunohistochemistry. Paraffin sections (5-mm thick) were deparaffinized, hydrated, and treated with 3% H2O2 in methanol for 20 min. The sections were blocked (1% BSA, 0.1% Tween-20 and 10% normal rabbit serum) before incubation overnight at 4C with our in-house antibody at a dilution of 1/2000 in blocking solution. A commercial detection system kit (Covance Research Products, Inc, Deham, Massachusetts) using streptavidin-biotin amplication method was then used. Finally, the antigen-antibody complex was visualized with a solution of PBS 1X containing 5 mg/ml of 3,3-diaminobenzidine and 0.012% H2O2. Sections were lightly counterstained with hematoxylin. Negative controls were done by incubating tissues with normal rabbit serum. Images were generated utilizing a 10X objective on the Leica DMRB.
 
X
Ask a Question