website statistics
Account Login 

Aviva Systems Biology office will be closed for Thanksgiving - Thursday 11/27/2014 and Friday 11/28/2014.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

E2F2 antibody - middle region (ARP38418_P050)

Description of Target:
E2F2 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1.The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
E2F transcription factor 2
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express E2F2.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Transcription factor E2F2
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-E2F2 antibody: synthetic peptide directed towards the middle region of human E2F2
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
E2F2 antibody - middle region (ARP38418_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 92%; Pig: 91%; Guinea pig: 91%; Zebrafish: 75%
Species Reactivity:
Dog, Horse, Rabbit, Rat, Mouse, Human, Bovine, Pig, Guinea pig, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-E2F2 antibody
- ARP38418_P050
Peptide Sequence:
Synthetic peptide located within the following region: DQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLI
Blocking Peptide:
For anti-E2F2 antibody is Catalog # AAP38418 (Previous Catalog # AAPP20608)
Target Reference:
Raj,D., (2008) Carcinogenesis 29 (1), 194-201
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-E2F2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for E2F2 antibody (ARP38418)

Product page for E2F2 antibody (ARP38418)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog e2f3 antibody; Xenopus laevis e2f3 antibody Q9IB10 81%
African clawed frog LOC398159 antibody; Xenopus laevis LOC398159 antibody Q4V880 81%
African elephant E2F2 antibody; Loxodonta africana E2F2 antibody G3TY99 91%
African elephant E2F2 antibody; Loxodonta africana E2F2 antibody G3SUK5 91%
African elephant E2F3 antibody; Loxodonta africana E2F3 antibody G3SLB2 90%
Bovine E2F2 antibody; Bos taurus E2F2 antibody E1BD75 91%
Bovine E2F3 antibody; Bos taurus E2F3 antibody F1MYH2 90%
Chicken E2F3 antibody; Gallus gallus E2F3 antibody F1P324 90%
Chicken E2F3 antibody; Gallus gallus E2F3 antibody F1NR90 90%
Chinese hamster E2f3 antibody; Cricetulus griseus E2f3 antibody G3GWW4 90%
Common turkey E2F2 antibody; Meleagris gallopavo E2F2 antibody G1MRX5 78%
Common turkey E2F3 antibody; Meleagris gallopavo E2F3 antibody G1MUB8 90%
Dog E2F2 antibody; Canis familiaris E2F2 antibody F1PG02 100%
Dog E2F3 antibody; Canis familiaris E2F3 antibody F1PUY3 90%
Duckbill platypus 100089048 antibody; Ornithorhynchus anatinus 100089048 antibody F7CK33 83%
Duckbill platypus 100089048 antibody; Ornithorhynchus anatinus 100089048 antibody F7CK24 83%
Duckbill platypus E2F3 antibody; Ornithorhynchus anatinus E2F3 antibody F6X653 81%
Giant panda LOC100475779 antibody; Ailuropoda melanoleuca LOC100475779 antibody G1LSV7 100%
Gray short-tailed opossum E2F3 antibody; Monodelphis domestica E2F3 antibody F6WI20 90%
Guinea pig E2F2 antibody; Cavia porcellus E2F2 antibody H0VD13 78%
Guinea pig LOC100722981 antibody; Cavia porcellus LOC100722981 antibody H0UTB9 90%
Horse E2F2 antibody; Equus caballus E2F2 antibody F6XW57 100%
Horse LOC100052248 antibody; Equus caballus LOC100052248 antibody F6UIL4 90%
Human E2F2 antibody; Homo sapiens E2F2 antibody Q14209 100%
Human E2F2 antibody; Homo sapiens E2F2 antibody Q5U0J0 100%
Human E2F3 antibody; Homo sapiens E2F3 antibody O00716 90%
Human E2F3 antibody; Homo sapiens E2F3 antibody Q68DT0 90%
Human E2F3 antibody; Homo sapiens E2F3 antibody Q499G5 90%
Human E2F3 antibody; Homo sapiens E2F3 antibody Q24JQ3 90%
Human E2F3 antibody; Homo sapiens E2F3 antibody F5H536 90%
Little brown bat E2F2 antibody; Myotis lucifugus E2F2 antibody G1PCB7 100%
Little brown bat E2F3 antibody; Myotis lucifugus E2F3 antibody G1NWJ8 90%
Lowland gorilla E2F2 antibody; Gorilla gorilla gorilla E2F2 antibody G3RQ22 100%
Lowland gorilla E2F2 antibody; Gorilla gorilla gorilla E2F2 antibody G3QKK9 100%
Lowland gorilla E2F3 antibody; Gorilla gorilla gorilla E2F3 antibody G3SFQ3 90%
Lowland gorilla E2F3 antibody; Gorilla gorilla gorilla E2F3 antibody G3R608 90%
Mouse E2F2 antibody; Mus musculus E2F2 antibody P56931 100%
Mouse E2f2 antibody; Mus musculus E2f2 antibody Q3U008 100%
Mouse E2f2 antibody; Mus musculus E2f2 antibody Q3TZQ9 100%
Mouse E2f2 antibody; Mus musculus E2f2 antibody E9Q883 100%
Mouse E2F3 antibody; Mus musculus E2F3 antibody O35261 90%
Mouse E2f3 antibody; Mus musculus E2f3 antibody Q8R1S8 90%
Mouse E2f3 antibody; Mus musculus E2f3 antibody Q6ZQJ8 90%
Mouse E2f3 antibody; Mus musculus E2f3 antibody Q6PCM3 90%
Mouse E2f3 antibody; Mus musculus E2f3 antibody Q3UZJ0 90%
Mouse E2f3 antibody; Mus musculus E2f3 antibody Q3TMJ9 90%
Northern white-cheeked gibbon E2F2 antibody; Nomascus leucogenys E2F2 antibody G1RB57 100%
Northern white-cheeked gibbon E2F3 antibody; Nomascus leucogenys E2F3 antibody G1QMD4 90%
Northern white-cheeked gibbon E2F3 antibody; Nomascus leucogenys E2F3 antibody G1QMC9 90%
Pig E2F3 antibody; Sus scrofa E2F3 antibody F1RUH1 90%
Purple sea urchin E2E3 antibody; Strongylocentrotus purpuratus E2E3 antibody B3FNR8 90%
Rabbit E2F2 antibody; Oryctolagus cuniculus E2F2 antibody G1TGK6 100%
Rabbit E2F3 antibody; Oryctolagus cuniculus E2F3 antibody G1T789 90%
Rat LOC100361421 antibody; Rattus norvegicus LOC100361421 antibody F1LVZ4 90%
Rat LOC100361421 antibody; Rattus norvegicus LOC100361421 antibody F1LUH1 90%
Rhesus macaque E2F2 antibody; Macaca mulatta E2F2 antibody F7H757 100%
Rhesus macaque E2F2 antibody; Macaca mulatta E2F2 antibody F7H728 100%
Rhesus macaque LOC713904 antibody; Macaca mulatta LOC713904 antibody F6UI87 90%
Rhesus macaque LOC713904 antibody; Macaca mulatta LOC713904 antibody F6UI75 90%
Small-eared galago E2F2 antibody; Otolemur garnettii E2F2 antibody H0X622 100%
Small-eared galago E2F3 antibody; Otolemur garnettii E2F3 antibody H0WPQ0 90%
Tasmanian devil E2F3 antibody; Sarcophilus harrisii E2F3 antibody G3WSU4 90%
Western clawed frog e2f3 antibody; Xenopus tropicalis e2f3 antibody Q5XGD5 81%
Western clawed frog e2f3 antibody; Xenopus tropicalis e2f3 antibody F6VW96 81%
White-tufted-ear marmoset E2F2 antibody; Callithrix jacchus E2F2 antibody F7IIE1 100%
White-tufted-ear marmoset LOC100390235 antibody; Callithrix jacchus LOC100390235 antibody F7HP13 81%
White-tufted-ear marmoset LOC100390235 antibody; Callithrix jacchus LOC100390235 antibody F7HDR8 81%
White-tufted-ear marmoset LOC100390235 antibody; Callithrix jacchus LOC100390235 antibody F7HDQ4 81%
White-tufted-ear marmoset LOC100390235 antibody; Callithrix jacchus LOC100390235 antibody F7H6S4 81%
White-tufted-ear marmoset LOC100390235 antibody; Callithrix jacchus LOC100390235 antibody F7DQN0 81%
White-tufted-ear marmoset LOC100390235 antibody; Callithrix jacchus LOC100390235 antibody F6T933 81%
Zebra finch E2F3 antibody; Taeniopygia guttata E2F3 antibody H0Z7G4 90%

Product Protocols: E2F2 antibody tested with Human Fetal Brain Tissue (ARP38418_P050)

Aviva Systems Biology is the original manufacturer of this E2F2 antibody (ARP38418_P050)

Click here to view the E2F2 antibody Western Blot Protocol

Product Datasheet Link: E2F2 antibody (ARP38418_P050)

WB Suggested Anti-E2F2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Fetal Brain

Western Blot image:

Description of Target: E2F2 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1.The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s E2F2 antibody (ARP38418_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question