website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

E2F2 antibody - middle region (ARP38418_P050)

Description of Target:
E2F2 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1.The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
E2F2
Official Gene Full Name:
E2F transcription factor 2
NCBI Gene Id:
1870
Alias Symbols:
E2F-2
Tissue Tool:
Find tissues and cell lines supported to express E2F2.
Protein Accession #:
NP_004082
Nucleotide Accession#:
NM_004091
Swissprot Id:
Q14209
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Transcription factor E2F2
Protein Size (# AA):
437
Molecular Weight:
47kDa
Application:
IHC, WB
Partner Proteins:
ATXN1, CREBBP, ESR1, ESR2, ID3, LMNA, MAPK1, MAPK3, NR0B1, SMARCD3, SP1, SREBF1, SUMO1, TWIST2, UBE2I, YY1, CREBBP, GAL11, LMNA, MAPK1, MAPK3, NR0B1, SP1, TWIST2, UBE2I, YY1
Immunogen:
The immunogen for anti-E2F2 antibody: synthetic peptide directed towards the middle region of human E2F2
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
E2F2 antibody - middle region (ARP38418_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 92%; Pig: 91%; Guinea pig: 91%; Zebrafish: 75%
Species Reactivity:
Dog, Horse, Rabbit, Rat, Mouse, Human, Bovine, Pig, Guinea pig, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-E2F2 antibody
- ARP38418_P050
Peptide Sequence:
Synthetic peptide located within the following region: DQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLI
Blocking Peptide:
For anti-E2F2 antibody is Catalog # AAP38418 (Previous Catalog # AAPP20608)
Key Reference:
Raj,D., (2008) Carcinogenesis 29 (1), 194-201
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-E2F2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question